StarFunc result for job id P49918

User Input

>input (316 residues)
MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNR
WDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLE
PAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAP
APAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLAD
QLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSA
APGVGSVEQTPRKRLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49918	0.999	0.999	3.340E-45	316	1.000	1.000	P49918.pdb.gz	CDN1C_HUMAN Cyclin-dependent kinase inhibitor 1C OS=Homo sapiens OX=9606 GN=CDKN1C PE=1 SV=1
2	AFDB:Q69DC1	0.271	0.243	3.541E-23	355	0.627	0.558	Q69DC1.pdb.gz	Q69DC1_RAT Cyclin-dependent kinase inhibitor 1C OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=3 SV=1
3	PDB:7b5lP	0.191	0.663	2.090E-4	77	0.101	0.416	7b5lP.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
4	AFDB:G5EB64	0.074	0.043	7.392E-1	687	0.180	0.083	G5EB64.pdb.gz	G5EB64_EMENI histone deacetylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04493 PE=3 SV=1
5	AFDB:Q7K4M4	0.109	0.061	9.691E-1	649	0.142	0.069	Q7K4M4.pdb.gz	TEF_DROME Protein teflon OS=Drosophila melanogaster OX=7227 GN=tef PE=1 SV=1
6	PDB:7w59R	0.103	0.115	9.906E-1	280	0.076	0.086	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
7	AFDB:E1C2F2	0.107	0.056	1.360	691	0.180	0.082	E1C2F2.pdb.gz	E1C2F2_CHICK Pinin OS=Gallus gallus OX=9031 GN=PNN PE=1 SV=3
8	AFDB:Q1JQ54	0.091	0.066	1.455	521	0.165	0.100	Q1JQ54.pdb.gz
9	AFDB:Q38BB5	0.112	0.097	1.455	392	0.174	0.140	Q38BB5.pdb.gz	Q38BB5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2340 PE=4 SV=1
10	AFDB:A0A068F1F8	0.095	0.076	1.557	414	0.146	0.111	A0A068F1F8.pdb.gz
11	AFDB:Q86R99	0.086	0.037	1.907	797	0.155	0.061	Q86R99.pdb.gz	Q86R99_DROME Myosin phosphatase DMBS-S OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
12	AFDB:P40791	0.100	0.067	2.041	540	0.149	0.087	P40791.pdb.gz	MEF2_DROME Myocyte-specific enhancer factor 2 OS=Drosophila melanogaster OX=7227 GN=Mef2 PE=1 SV=3
13	PDB:7qdsA	0.066	0.108	2.086	155	0.044	0.090	7qdsA.pdb.gz
14	PDB:6ff4C	0.112	0.121	4.394	286	0.073	0.080	6ff4C.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
15	PDB:1sksA	0.068	0.035	5.383	681	0.054	0.025	1sksA.pdb.gz	Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
16	PDB:2ajqA	0.080	0.038	5.760	704	0.060	0.027	2ajqA.pdb.gz	Structure of replicative DNA polymerase provides insigts into the mechanisms for processivity, frameshifting and editing
17	PDB:7odrS	0.083	0.125	7.552	161	0.044	0.087	7odrS.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
18	PDB:7qsoC	0.076	0.104	7.552	210	0.038	0.057	7qsoC.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
19	PDB:6aggZ	0.080	0.063	8.647	420	0.035	0.026	6aggZ.pdb.gz	Structure of tRNA-Modifying Enzyme TiaS and Motions of Its Substrate Binding Zinc Ribbon.
20	PDB:6yxyBO	0.082	0.105	9.253	215	0.063	0.093	6yxyBO.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P49918	0.0	595	316	1.000	1.000	CDN1C_HUMAN Cyclin-dependent kinase inhibitor 1C OS=Homo sapiens OX=9606 GN=CDKN1C PE=1 SV=1
2	Q69DC1	9.22e-99	296	355	0.601	0.535	Q69DC1_RAT Cyclin-dependent kinase inhibitor 1C OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=3 SV=1
3	P49919	2.30e-87	267	348	0.585	0.532	CDN1C_MOUSE Cyclin-dependent kinase inhibitor 1C OS=Mus musculus OX=10090 GN=Cdkn1c PE=1 SV=2
4	Q69DC0	7.54e-85	261	343	0.573	0.528	Q69DC0_RAT CDKI protein OS=Rattus norvegicus OX=10116 GN=Cdkn1c PE=2 SV=1
5	Q6IQT7	2.39e-28	110	212	0.146	0.217	Q6IQT7_DANRE Cyclin-dependent kinase inhibitor 1C OS=Danio rerio OX=7955 GN=cdkn1c PE=2 SV=1
6	O08769	7.18e-18	82.4	197	0.161	0.259	O08769_RAT Cyclin dependent kinase inhibitor OS=Rattus norvegicus OX=10116 GN=Cdkn1b PE=1 SV=1
7	O43806	1.23e-17	80.5	158	0.158	0.316	O43806_HUMAN p27 kip1 protein (Fragment) OS=Homo sapiens OX=9606 GN=p27 kip1 PE=1 SV=1
8	Q96TE0	1.77e-17	81.3	198	0.158	0.253	Q96TE0_HUMAN Cdk inhibitor p27KIP1 OS=Homo sapiens OX=9606 PE=1 SV=1
9	P46527	4.08e-17	80.1	198	0.123	0.197	CDN1B_HUMAN Cyclin-dependent kinase inhibitor 1B OS=Homo sapiens OX=9606 GN=CDKN1B PE=1 SV=1
10	Q6I9V6	4.08e-17	80.1	198	0.123	0.197	Q6I9V6_HUMAN CDKN1B protein OS=Homo sapiens OX=9606 GN=CDKN1B PE=2 SV=1
11	P46414	1.35e-16	79.0	197	0.123	0.198	CDN1B_MOUSE Cyclin-dependent kinase inhibitor 1B OS=Mus musculus OX=10090 GN=Cdkn1b PE=1 SV=2
12	Q91603	1.65e-15	76.3	210	0.095	0.143	Q91603_XENLA XICL OS=Xenopus laevis OX=8355 GN=Xicl PE=2 SV=1
13	A0A8I5ZZ18	5.26e-10	59.7	169	0.095	0.178	A0A8I5ZZ18_RAT Cyclin-dependent kinase inhibitor 1A OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=3 SV=1
14	Q64315	6.44e-10	59.3	164	0.095	0.183	Q64315_RAT Cyclin-dependent kinase inhibitor 1A OS=Rattus norvegicus OX=10116 GN=Cdkn1a PE=2 SV=1
15	Q22198	1.92e-09	59.7	258	0.114	0.140	Q22198_CAEEL Cyclin-dependent kinase inhibitor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cki-2 PE=1 SV=2
16	U4PBK8	2.68e-09	57.8	175	0.114	0.206	U4PBK8_CAEEL Cyclin-dependent kinase inhibitor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cki-2 PE=1 SV=1
17	P39689	2.98e-09	57.4	159	0.092	0.182	CDN1A_MOUSE Cyclin-dependent kinase inhibitor 1 OS=Mus musculus OX=10090 GN=Cdkn1a PE=1 SV=4
18	Q564P6	2.98e-09	57.4	159	0.092	0.182	Q564P6_MOUSE Cyclin-dependent kinase inhibitor 1A variant 1 OS=Mus musculus OX=10090 GN=Cdkn1a PE=2 SV=1
19	P38936	4.08e-09	57.0	164	0.085	0.165	CDN1A_HUMAN Cyclin-dependent kinase inhibitor 1 OS=Homo sapiens OX=9606 GN=CDKN1A PE=1 SV=3
20	A5WWG2	2.46e-08	54.7	154	0.089	0.182	A5WWG2_DANRE Cyclin-dependent kinase inhibitor 1 OS=Danio rerio OX=7955 GN=cip1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02234 CDI	5.4e-13	60.2	Cyclin-dependent kinase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413720

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
2	9606.ENSP00000274026	0.995	Cyclin-A2
3	9606.ENSP00000261254	0.977	G1/S-specific cyclin-D2
4	9606.ENSP00000362082	0.977	G1/S-specific cyclin-D3
5	9606.ENSP00000262643	0.974	G1/S-specific cyclin-E1
6	9606.ENSP00000227507	0.972	G1/S-specific cyclin-D1
7	9606.ENSP00000429089	0.971	G1/S-specific cyclin-E2
8	9606.ENSP00000362768	0.967	Retinoblastoma-like protein 1
9	9606.ENSP00000256443	0.963	Cyclin-dependent kinase 7
10	9606.ENSP00000267163	0.963	Retinoblastoma-associated protein
11	9606.ENSP00000265734	0.960	Cyclin-dependent kinase 6
12	9606.ENSP00000274255	0.960	S-phase kinase-associated protein 2
13	9606.ENSP00000262904	0.956	Transcription factor E2F3
14	9606.ENSP00000345571	0.956	Transcription factor E2F1
15	9606.ENSP00000257904	0.950	Cyclin-dependent kinase 4
16	9606.ENSP00000336740	0.950	LIM domain kinase 1
17	9606.ENSP00000262133	0.946	Retinoblastoma-like protein 2
18	9606.ENSP00000355249	0.946	Transcription factor E2F2
19	9606.ENSP00000368686	0.943	Transcription factor E2F4
20	9606.ENSP00000398124	0.941	Transcription factor E2F5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.999	protein-containing complex binding
GO:0019210	0.995	kinase inhibitor activity
GO:0004860	0.991	protein kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048523	0.989	negative regulation of cellular process
GO:0048522	0.987	positive regulation of cellular process
GO:0043549	0.986	regulation of kinase activity
GO:0042127	0.985	regulation of cell population proliferation
GO:0001932	0.985	regulation of protein phosphorylation
GO:0042326	0.981	negative regulation of phosphorylation
GO:0045859	0.975	regulation of protein kinase activity
GO:0009966	0.971	regulation of signal transduction
GO:0051173	0.969	positive regulation of nitrogen compound metabolic process
GO:0051348	0.958	negative regulation of transferase activity
GO:0033673	0.948	negative regulation of kinase activity
GO:0051726	0.945	regulation of cell cycle
GO:0019219	0.936	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.930	positive regulation of macromolecule metabolic process
GO:0006355	0.925	regulation of DNA-templated transcription
GO:0051172	0.919	negative regulation of nitrogen compound metabolic process
GO:0031325	0.918	positive regulation of cellular metabolic process
GO:0031400	0.902	negative regulation of protein modification process
GO:1904029	0.900	regulation of cyclin-dependent protein kinase activity
GO:0045892	0.895	negative regulation of DNA-templated transcription
GO:0006469	0.885	negative regulation of protein kinase activity
GO:0045935	0.869	positive regulation of nucleobase-containing compound metabolic process
GO:0009987	0.831	cellular process
GO:0050678	0.725	regulation of epithelial cell proliferation
GO:0090092	0.723	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009891	0.719	positive regulation of biosynthetic process
GO:0008285	0.716	negative regulation of cell population proliferation
GO:0045893	0.704	positive regulation of DNA-templated transcription
GO:0090287	0.701	regulation of cellular response to growth factor stimulus
GO:1903844	0.676	regulation of cellular response to transforming growth factor beta stimulus
GO:0017015	0.634	regulation of transforming growth factor beta receptor signaling pathway
GO:0048584	0.577	positive regulation of response to stimulus
GO:0009967	0.481	positive regulation of signal transduction
GO:0050896	0.417	response to stimulus
GO:0008152	0.334	metabolic process
GO:0032502	0.320	developmental process
GO:0071704	0.312	organic substance metabolic process
GO:0050680	0.308	negative regulation of epithelial cell proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.555	intracellular organelle lumen
GO:0031981	0.549	nuclear lumen
GO:0005654	0.505	nucleoplasm
GO:0032991	0.437	protein-containing complex
GO:0005829	0.432	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]