StarFunc result for job id P49959

User Input

>input (708 residues)
MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGD
LFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISI
PVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYG
LGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDL
VIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIP
LHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEK
PLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITK
PSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEK
TQRFLKERHIDALEDKIDEEVRRFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAF
SADDLMSIDLAEQMANDSDDSISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLE
TSTRSRNSKTAVSASRNMSIIDAFKSTRQQPSRNVTTKNYSEVIEVDESDVEEDIFPTTS
KTDQRWSSTSSSKIMSQSQVSKGVDFESSEDDDDDPFMNTSSLRRNRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R395	0.712	0.712	0.000	708	1.000	1.000	A0A024R395.pdb.gz
2	AFDB:Q61216	0.769	0.771	0.000	706	0.883	0.885	Q61216.pdb.gz	MRE11_MOUSE Double-strand break repair protein MRE11 OS=Mus musculus OX=10090 GN=Mre11 PE=1 SV=1
3	AFDB:Q9IAM7	0.769	0.777	0.000	700	0.734	0.743	Q9IAM7.pdb.gz	MRE11_CHICK Double-strand break repair protein MRE11 OS=Gallus gallus OX=9031 GN=MRE11 PE=2 SV=1
4	AFDB:Q9XYZ4	0.577	0.656	5.789E-64	620	0.362	0.413	Q9XYZ4.pdb.gz	Q9XYZ4_DROME Double-strand break repair protein OS=Drosophila melanogaster OX=7227 GN=mre11 PE=1 SV=1
5	AFDB:Q09683	0.585	0.636	2.765E-62	649	0.336	0.367	Q09683.pdb.gz	RAD32_SCHPO DNA repair protein rad32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad32 PE=1 SV=1
6	AFDB:P32829	0.562	0.575	1.956E-59	692	0.339	0.347	P32829.pdb.gz	MRE11_YEAST Double-strand break repair protein MRE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRE11 PE=1 SV=2
7	AFDB:Q23255	0.554	0.540	6.457E-57	728	0.325	0.316	Q23255.pdb.gz	MRE11_CAEEL Double-strand break repair protein mre-11 OS=Caenorhabditis elegans OX=6239 GN=mre-11 PE=1 SV=2
8	PDB:3thoB	0.330	0.579	3.500E-14	366	0.127	0.246	3thoB.pdb.gz	ATP driven structural changes of the bacterial Mre11:Rad50 catalytic head complex.
9	PDB:3av0A	0.329	0.589	5.494E-13	369	0.082	0.157	3av0A.pdb.gz	Crystal Structure of the Mre11-Rad50-ATP S Complex: Understanding the Interplay between Mre11 and Rad50
10	PDB:6s6vA	0.316	0.530	2.624E-11	386	0.088	0.161	6s6vA.pdb.gz	Mechanism of DNA End Sensing and Processing by the Mre11-Rad50 Complex.
11	PDB:6s85B	0.300	0.546	8.320E-10	356	0.085	0.169	6s85B.pdb.gz	Mechanism of DNA End Sensing and Processing by the Mre11-Rad50 Complex.
12	PDB:1ho5A	0.226	0.290	5.024E-8	525	0.064	0.086	1ho5A.pdb.gz	Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
13	PDB:2bq8X	0.264	0.555	7.571E-8	304	0.068	0.158	2bq8X.pdb.gz	Crystal Structures of Recombinant Human Purple Acid Phosphatase with and without an Inhibitory Conformation of the Repression Loop.
14	PDB:3ib7A	0.238	0.502	2.913E-7	295	0.056	0.136	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability
15	PDB:2nxfA	0.220	0.437	7.176E-5	314	0.055	0.124	2nxfA.pdb.gz	Crystal Structure of a dimetal phosphatase from Danio rerio LOC 393393
16	PDB:5wlyA	0.201	0.555	9.618E-5	220	0.047	0.150	5wlyA.pdb.gz	The substrate-binding cap of the UDP-diacylglucosamine pyrophosphatase LpxH is highly flexible, enabling facile substrate binding and product release.
17	PDB:4b2oA	0.206	0.438	1.020E-4	264	0.054	0.144	4b2oA.pdb.gz	The Ymdb Phosphodiesterase is a Global Regulator of Late Adaptive Responses in Bacillus Subtilis.
18	AFDB:O94864	0.090	0.133	2.518E-1	414	0.089	0.152	O94864.pdb.gz	ST65G_HUMAN STAGA complex 65 subunit gamma OS=Homo sapiens OX=9606 GN=SUPT7L PE=1 SV=1
19	AFDB:Q54TY7	0.065	0.104	2.518E-1	418	0.037	0.062	Q54TY7.pdb.gz	SRFA_DICDI Serum response factor homolog A OS=Dictyostelium discoideum OX=44689 GN=srfA PE=1 SV=1
20	AFDB:Q5AAF4	0.069	0.036	3.578E-1	1485	0.086	0.041	Q5AAF4.pdb.gz	BNR1_CANAL Formin BNR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNR1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W7U8	0.0	1458	707	0.999	1.000	F8W7U8_HUMAN Double-strand break repair protein OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=1
2	P49959	0.0	1466	708	1.000	1.000	MRE11_HUMAN Double-strand break repair protein MRE11 OS=Homo sapiens OX=9606 GN=MRE11 PE=1 SV=3
3	Q61216	0.0	1242	706	0.883	0.885	MRE11_MOUSE Double-strand break repair protein MRE11 OS=Mus musculus OX=10090 GN=Mre11 PE=1 SV=1
4	Q9IAM7	0.0	1026	700	0.729	0.737	MRE11_CHICK Double-strand break repair protein MRE11 OS=Gallus gallus OX=9031 GN=MRE11 PE=2 SV=1
5	Q9JIM0	0.0	1226	706	0.879	0.881	MRE11_RAT Double-strand break repair protein MRE11 OS=Rattus norvegicus OX=10116 GN=Mre11 PE=1 SV=1
6	Q09683	2.32e-149	451	649	0.333	0.364	RAD32_SCHPO DNA repair protein rad32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad32 PE=1 SV=1
7	Q9XYZ4	2.87e-139	424	620	0.328	0.374	Q9XYZ4_DROME Double-strand break repair protein OS=Drosophila melanogaster OX=7227 GN=mre11 PE=1 SV=1
8	Q9XGM2	8.22e-136	418	720	0.352	0.346	MRE11_ARATH Double-strand break repair protein MRE11 OS=Arabidopsis thaliana OX=3702 GN=MRE11 PE=1 SV=1
9	Q7XQR9	3.77e-132	408	705	0.312	0.313	MRE11_ORYSJ Double-strand break repair protein MRE11 OS=Oryza sativa subsp. japonica OX=39947 GN=MRE11 PE=1 SV=2
10	P32829	7.01e-130	402	692	0.316	0.324	MRE11_YEAST Double-strand break repair protein MRE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRE11 PE=1 SV=2
11	A0A1D8PQT2	8.70e-126	391	682	0.285	0.296	A0A1D8PQT2_CANAL Double-strand break repair protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MRE11 PE=3 SV=1
12	Q23255	1.52e-117	371	728	0.298	0.290	MRE11_CAEEL Double-strand break repair protein mre-11 OS=Caenorhabditis elegans OX=6239 GN=mre-11 PE=1 SV=2
13	Q586P4	5.87e-99	323	763	0.312	0.290	Q586P4_TRYB2 Endo/exonuclease Mre11 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.385 PE=4 SV=1
14	Q8T8P1	6.25e-99	323	763	0.312	0.290	Q8T8P1_TRYBB DNA repair protein Mre11 OS=Trypanosoma brucei brucei OX=5702 GN=MRE11 PE=4 SV=1
15	Q8WPP1	6.39e-99	323	763	0.312	0.290	Q8WPP1_9TRYP Mre11 protein OS=Trypanosoma brucei OX=5691 GN=Mre11 PE=4 SV=1
16	Q8U1N9	9.48e-06	51.2	426	0.061	0.101	MRE11_PYRFU DNA double-strand break repair protein Mre11 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=mre11 PE=1 SV=2
17	Q9X1X0	0.001	44.7	385	0.045	0.083	Q9X1X0_THEMA Nuclease SbcCD subunit D OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=sbcD PE=1 SV=1
18	Q8NR87	0.007	42.0	391	0.076	0.138	Q8NR87_CORGL DNA repair exonuclease OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=Cgl1166 PE=4 SV=1
19	Q6P3W6	0.031	40.4	3795	0.047	0.009	NBPFA_HUMAN Neuroblastoma breakpoint family member 10 OS=Homo sapiens OX=9606 GN=NBPF10 PE=3 SV=3
20	A0A087WUL8	0.90	35.4	3843	0.045	0.008	NBPFJ_HUMAN Neuroblastoma breakpoint family member 19 OS=Homo sapiens OX=9606 GN=NBPF19 PE=5 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00149 Metallophos	9.2e-13	60.7	Calcineurin-like phosphoesterase
2	PF04152 Mre11_DNA_bind	3e-45	166.1	Mre11 DNA-binding presumed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265433	0.999	Nibrin
2	9606.ENSP00000278616	0.999	Serine-protein kinase ATM
3	9606.ENSP00000368100	0.999	DNA repair protein RAD50
4	9606.ENSP00000371475	0.997	TP53-binding protein 1
5	9606.ENSP00000418960	0.996	Breast cancer type 1 susceptibility protein
6	9606.ENSP00000352257	0.994	X-ray repair cross-complementing protein 6
7	9606.ENSP00000382628	0.994	DNA endonuclease RBBP8
8	9606.ENSP00000355506	0.993	Exonuclease 1
9	9606.ENSP00000365588	0.993	Mediator of DNA damage checkpoint protein 1
10	9606.ENSP00000375978	0.993	X-ray repair cross-complementing protein 5
11	9606.ENSP00000434024	0.993	Histone H2AX
12	9606.ENSP00000254942	0.992	Telomeric repeat-binding factor 2
13	9606.ENSP00000347232	0.992	Bloom syndrome protein
14	9606.ENSP00000300086	0.991	Telomeric repeat-binding factor 2-interacting protein 1
15	9606.ENSP00000318977	0.986	Flap endonuclease GEN homolog 1
16	9606.ENSP00000343741	0.985	Serine/threonine-protein kinase ATR
17	9606.ENSP00000287647	0.984	Fanconi anemia group D2 protein
18	9606.ENSP00000360310	0.983	Meiotic recombination protein SPO11
19	9606.ENSP00000372023	0.983	Serine/threonine-protein kinase Chk2
20	9606.ENSP00000372088	0.983	DNA repair protein RAD51 homolog 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.957	catalytic activity
GO:1901363	0.846	heterocyclic compound binding
GO:0097159	0.846	organic cyclic compound binding
GO:0016787	0.805	hydrolase activity
GO:0003676	0.786	nucleic acid binding
GO:0003677	0.754	DNA binding
GO:0016788	0.567	hydrolase activity, acting on ester bonds

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006259	0.991	DNA metabolic process
GO:0006974	0.990	cellular response to DNA damage stimulus
GO:0050789	0.987	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0006281	0.969	DNA repair
GO:0006302	0.961	double-strand break repair
GO:0048519	0.950	negative regulation of biological process
GO:0006310	0.920	DNA recombination
GO:0071840	0.906	cellular component organization or biogenesis
GO:0016043	0.900	cellular component organization
GO:0006996	0.887	organelle organization
GO:0007049	0.885	cell cycle
GO:1901987	0.884	regulation of cell cycle phase transition
GO:0048523	0.882	negative regulation of cellular process
GO:0022402	0.879	cell cycle process
GO:0019222	0.856	regulation of metabolic process
GO:0010948	0.851	negative regulation of cell cycle process
GO:0060255	0.842	regulation of macromolecule metabolic process
GO:0007127	0.840	meiosis I
GO:0051276	0.837	chromosome organization
GO:1901988	0.818	negative regulation of cell cycle phase transition
GO:0051171	0.812	regulation of nitrogen compound metabolic process
GO:0080090	0.807	regulation of primary metabolic process
GO:0031323	0.806	regulation of cellular metabolic process
GO:0007131	0.789	reciprocal meiotic recombination
GO:0000075	0.780	cell cycle checkpoint signaling
GO:0048518	0.716	positive regulation of biological process
GO:0019219	0.711	regulation of nucleobase-containing compound metabolic process
GO:0051052	0.582	regulation of DNA metabolic process
GO:0048522	0.541	positive regulation of cellular process
GO:0010604	0.452	positive regulation of macromolecule metabolic process
GO:0051173	0.448	positive regulation of nitrogen compound metabolic process
GO:0031325	0.443	positive regulation of cellular metabolic process
GO:0000278	0.435	mitotic cell cycle
GO:0032200	0.374	telomere organization
GO:0042770	0.374	signal transduction in response to DNA damage
GO:1903047	0.360	mitotic cell cycle process
GO:0000077	0.346	DNA damage checkpoint signaling
GO:0007346	0.343	regulation of mitotic cell cycle
GO:0045930	0.319	negative regulation of mitotic cell cycle
GO:1901990	0.310	regulation of mitotic cell cycle phase transition
GO:0045935	0.302	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0005737	0.798	cytoplasm
GO:0005694	0.538	chromosome
GO:0032991	0.384	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.805	Hydrolases.
EC:3.1.-.-	0.567	Acting on ester bonds.

[back to server]