StarFunc result for job id P50052

User Input

>input (363 residues)
MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLDAIPILYYIIFVIGFL
VNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVF
GSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYIVPLVWCMACLSSLPTFY
FRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLK
TNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLAL
PFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRESMSCRKSSSLREMET
FVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35351	0.918	0.918	9.713E-44	363	0.923	0.923	P35351.pdb.gz	AGTR2_RAT Type-2 angiotensin II receptor OS=Rattus norvegicus OX=10116 GN=Agtr2 PE=1 SV=1
2	AFDB:Q7SZP9	0.780	0.782	3.321E-20	362	0.303	0.304	Q7SZP9.pdb.gz	APJA_DANRE Apelin receptor A OS=Danio rerio OX=7955 GN=aplnra PE=1 SV=2
3	AFDB:P32303	0.778	0.780	4.526E-20	362	0.331	0.331	P32303.pdb.gz	AGTRA_XENLA Type-1 angiotensin II receptor A OS=Xenopus laevis OX=8355 GN=agtr1-a PE=2 SV=2
4	AFDB:P30411	0.782	0.728	7.692E-20	391	0.303	0.281	P30411.pdb.gz	BKRB2_HUMAN B2 bradykinin receptor OS=Homo sapiens OX=9606 GN=BDKRB2 PE=1 SV=2
5	AFDB:A0T2N3	0.783	0.791	9.180E-20	359	0.292	0.295	A0T2N3.pdb.gz	APJB_DANRE Apelin receptor B OS=Danio rerio OX=7955 GN=aplnrb PE=1 SV=1
6	AFDB:Q2TAD5	0.749	0.749	1.704E-19	363	0.298	0.298	Q2TAD5.pdb.gz	APJB_XENLA Apelin receptor B OS=Xenopus laevis OX=8355 GN=aplnr-b PE=2 SV=1
7	AFDB:P35373	0.781	0.781	4.312E-19	363	0.306	0.306	P35373.pdb.gz	AGTRB_XENLA Type-1 angiotensin II receptor B OS=Xenopus laevis OX=8355 GN=agtr1-b PE=2 SV=1
8	AFDB:Q8HZN9	0.740	0.759	5.876E-19	353	0.262	0.269	Q8HZN9.pdb.gz	BKRB1_PIG B1 bradykinin receptor OS=Sus scrofa OX=9823 GN=BDKRB1 PE=3 SV=1
9	AFDB:O35210	0.763	0.771	8.368E-19	359	0.309	0.312	O35210.pdb.gz	AGTR1_MERUN Type-1 angiotensin II receptor OS=Meriones unguiculatus OX=10047 GN=AGTR1 PE=2 SV=1
10	AFDB:Q8TDU9	0.737	0.717	8.368E-19	374	0.292	0.283	Q8TDU9.pdb.gz	RL3R2_HUMAN Relaxin-3 receptor 2 OS=Homo sapiens OX=9606 GN=RXFP4 PE=1 SV=1
11	PDB:7f6hA	0.750	0.887	8.961E-18	305	0.270	0.321	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
12	PDB:7eibA	0.748	0.914	1.221E-17	295	0.253	0.312	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.
13	PDB:7vl9R	0.746	0.889	2.258E-16	302	0.251	0.301	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
14	PDB:7f1qR	0.732	0.724	3.671E-16	367	0.237	0.234	7f1qR.pdb.gz
15	PDB:7wicR	0.710	0.884	8.134E-16	288	0.245	0.309	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
16	PDB:8ef5M	0.703	0.875	2.567E-15	288	0.248	0.312	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
17	PDB:7sk8A	0.728	0.857	3.656E-15	306	0.267	0.317	7sk8A.pdb.gz	Structures of atypical chemokine receptor 3 reveal the basis for its promiscuity and signaling bias.
18	PDB:7f1tA	0.694	0.601	1.104E-14	423	0.242	0.208	7f1tA.pdb.gz	Structural basis for chemokine recognition and receptor activation of chemokine receptor CCR5.
19	PDB:6lfmR	0.741	0.870	1.260E-14	307	0.240	0.283	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
20	PDB:7wq3R	0.718	0.893	1.317E-14	289	0.215	0.270	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35351	0.0	662	363	0.923	0.923	AGTR2_RAT Type-2 angiotensin II receptor OS=Rattus norvegicus OX=10116 GN=Agtr2 PE=1 SV=1
2	P35374	0.0	659	363	0.917	0.917	AGTR2_MOUSE Type-2 angiotensin II receptor OS=Mus musculus OX=10090 GN=Agtr2 PE=1 SV=1
3	P50052	0.0	745	363	1.000	1.000	AGTR2_HUMAN Type-2 angiotensin II receptor OS=Homo sapiens OX=9606 GN=AGTR2 PE=1 SV=1
4	P30555	6.59e-66	214	359	0.320	0.323	AGTR1_PIG Type-1 angiotensin II receptor OS=Sus scrofa OX=9823 GN=AGTR1 PE=2 SV=1
5	P29089	1.31e-65	213	359	0.317	0.320	AGTRB_RAT Type-1 angiotensin II receptor B OS=Rattus norvegicus OX=10116 GN=Agtr1b PE=2 SV=1
6	P25104	5.39e-65	212	359	0.298	0.301	AGTR1_BOVIN Type-1 angiotensin II receptor OS=Bos taurus OX=9913 GN=AGTR1 PE=2 SV=1
7	P32303	5.99e-65	212	362	0.311	0.312	AGTRA_XENLA Type-1 angiotensin II receptor A OS=Xenopus laevis OX=8355 GN=agtr1-a PE=2 SV=2
8	P43240	7.85e-65	211	359	0.314	0.318	AGTR1_CANLF Type-1 angiotensin II receptor OS=Canis lupus familiaris OX=9615 GN=AGTR1 PE=2 SV=1
9	P29755	8.19e-65	211	359	0.322	0.326	AGTRB_MOUSE Type-1 angiotensin II receptor B OS=Mus musculus OX=10090 GN=Agtr1b PE=3 SV=1
10	P29754	1.33e-64	211	359	0.314	0.318	AGTRA_MOUSE Type-1 angiotensin II receptor A OS=Mus musculus OX=10090 GN=Agtr1a PE=1 SV=1
11	P25095	2.04e-64	210	359	0.314	0.318	AGTRA_RAT Type-1 angiotensin II receptor A OS=Rattus norvegicus OX=10116 GN=Agtr1 PE=1 SV=1
12	P30556	7.37e-64	209	359	0.295	0.298	AGTR1_HUMAN Type-1 angiotensin II receptor OS=Homo sapiens OX=9606 GN=AGTR1 PE=1 SV=1
13	P35373	8.77e-64	209	363	0.311	0.311	AGTRB_XENLA Type-1 angiotensin II receptor B OS=Xenopus laevis OX=8355 GN=agtr1-b PE=2 SV=1
14	O35210	1.66e-63	208	359	0.320	0.323	AGTR1_MERUN Type-1 angiotensin II receptor OS=Meriones unguiculatus OX=10047 GN=AGTR1 PE=2 SV=1
15	Q6NUP5	1.76e-63	208	359	0.292	0.295	Q6NUP5_HUMAN Type-1 angiotensin II receptor OS=Homo sapiens OX=9606 GN=AGTR1 PE=1 SV=1
16	Q7SZP9	2.54e-57	192	362	0.322	0.323	APJA_DANRE Apelin receptor A OS=Danio rerio OX=7955 GN=aplnra PE=1 SV=2
17	A0T2N3	9.85e-55	185	359	0.295	0.298	APJB_DANRE Apelin receptor B OS=Danio rerio OX=7955 GN=aplnrb PE=1 SV=1
18	P79960	4.16e-52	178	362	0.311	0.312	APJA_XENLA Apelin receptor A OS=Xenopus laevis OX=8355 GN=aplnr-a PE=1 SV=2
19	Q2TAD5	2.32e-51	176	363	0.311	0.311	APJB_XENLA Apelin receptor B OS=Xenopus laevis OX=8355 GN=aplnr-b PE=2 SV=1
20	P32246	3.27e-51	176	355	0.270	0.276	CCR1_HUMAN C-C chemokine receptor type 1 OS=Homo sapiens OX=9606 GN=CCR1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.1e-53	193.9	7 transmembrane receptor (rhodopsin family)
2	PF00487 FA_desaturase	20	16.5	Fatty acid desaturase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360973

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355627	0.998	Angiotensinogen
2	9606.ENSP00000368683	0.948	Endothelin-1
3	9606.ENSP00000360141	0.919	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
4	9606.ENSP00000078429	0.918	Guanine nucleotide-binding protein subunit alpha-11
5	9606.ENSP00000290866	0.916	Angiotensin-converting enzyme
6	9606.ENSP00000312262	0.916	Beta-adrenergic receptor kinase 1
7	9606.ENSP00000409581	0.916	Beta-arrestin-1
8	9606.ENSP00000305372	0.915	Beta-2 adrenergic receptor
9	9606.ENSP00000481878	0.913	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
10	9606.ENSP00000306662	0.912	Alpha-1B adrenergic receptor
11	9606.ENSP00000343027	0.911	Guanine nucleotide-binding protein G(i) subunit alpha-1
12	9606.ENSP00000379140	0.909	Stromal cell-derived factor 1
13	9606.ENSP00000428056	0.909	Phosphatidylinositol 3-kinase regulatory subunit alpha
14	9606.ENSP00000263967	0.907	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
15	9606.ENSP00000276198	0.907	5-hydroxytryptamine receptor 2C
16	9606.ENSP00000308541	0.907	Prothrombin
17	9606.ENSP00000262102	0.906	Microtubule-associated tumor suppressor 1
18	9606.ENSP00000292303	0.906	C-C chemokine receptor type 5
19	9606.ENSP00000386884	0.905	C-X-C chemokine receptor type 4
20	9606.ENSP00000482259	0.905	C-C motif chemokine 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008528	1.000	G protein-coupled peptide receptor activity
GO:0005515	0.987	protein binding
GO:0003824	0.363	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.988	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.985	cellular process
GO:0032501	0.975	multicellular organismal process
GO:0051716	0.966	cellular response to stimulus
GO:0097746	0.953	blood vessel diameter maintenance
GO:0050886	0.934	endocrine process
GO:0003044	0.933	regulation of systemic arterial blood pressure mediated by a chemical signal
GO:0007154	0.929	cell communication
GO:0023052	0.925	signaling
GO:0007186	0.918	G protein-coupled receptor signaling pathway
GO:0001990	0.915	regulation of systemic arterial blood pressure by hormone
GO:0048518	0.913	positive regulation of biological process
GO:0022603	0.879	regulation of anatomical structure morphogenesis
GO:0003014	0.834	renal system process
GO:0051239	0.816	regulation of multicellular organismal process
GO:0032502	0.785	developmental process
GO:0060688	0.773	regulation of morphogenesis of a branching structure
GO:0048856	0.720	anatomical structure development
GO:1905330	0.682	regulation of morphogenesis of an epithelium
GO:0007275	0.671	multicellular organism development
GO:0051094	0.627	positive regulation of developmental process
GO:0042221	0.614	response to chemical
GO:0048731	0.576	system development
GO:0070887	0.536	cellular response to chemical stimulus
GO:1905332	0.532	positive regulation of morphogenesis of an epithelium
GO:0010033	0.531	response to organic substance
GO:0048522	0.525	positive regulation of cellular process
GO:0071704	0.511	organic substance metabolic process
GO:0006950	0.489	response to stress
GO:0048583	0.486	regulation of response to stimulus
GO:0019222	0.476	regulation of metabolic process
GO:0010646	0.455	regulation of cell communication
GO:0009966	0.454	regulation of signal transduction
GO:0031323	0.450	regulation of cellular metabolic process
GO:0048519	0.446	negative regulation of biological process
GO:0080090	0.444	regulation of primary metabolic process
GO:0048523	0.436	negative regulation of cellular process
GO:0035556	0.424	intracellular signal transduction
GO:0048584	0.410	positive regulation of response to stimulus
GO:0060255	0.400	regulation of macromolecule metabolic process
GO:0051171	0.396	regulation of nitrogen compound metabolic process
GO:0009893	0.377	positive regulation of metabolic process
GO:0065009	0.368	regulation of molecular function
GO:0006807	0.345	nitrogen compound metabolic process
GO:0071310	0.329	cellular response to organic substance
GO:0032879	0.323	regulation of localization
GO:0044237	0.309	cellular metabolic process
GO:0031325	0.305	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0031982	0.855	vesicle
GO:0005622	0.806	intracellular anatomical structure
GO:0043231	0.789	intracellular membrane-bounded organelle
GO:0005737	0.776	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]