StarFunc result for job id P50053

User Input

>input (298 residues)
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSMAPGHVADFLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
SATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELF
QLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLL
HSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50053	1.000	1.000	1.515E-69	298	1.000	1.000	P50053.pdb.gz	KHK_HUMAN Ketohexokinase OS=Homo sapiens OX=9606 GN=KHK PE=1 SV=2
2	AFDB:P97328	0.996	0.996	4.987E-64	298	0.869	0.869	P97328.pdb.gz	KHK_MOUSE Ketohexokinase OS=Mus musculus OX=10090 GN=Khk PE=1 SV=1
3	PDB:5wbmB	0.940	0.927	3.206E-62	302	0.987	0.974	5wbmB.pdb.gz	Discovery of Fragment-Derived Small Molecules for in Vivo Inhibition of Ketohexokinase (KHK).
4	PDB:6p2dA	0.987	0.993	4.431E-61	296	0.866	0.872	6p2dA.pdb.gz	First Crystal Structure of Mouse Ketohexokinase-C (KHK-C) Confirms Structural Similarity to Human KHK-C and Suggests Alternate Confirmation May Be Linked to Catalysis
5	PDB:2hw1A	0.981	0.988	1.699E-60	296	0.899	0.905	2hw1A.pdb.gz	Structures of alternatively spliced isoforms of human ketohexokinase.
6	PDB:7ag6A	0.816	0.805	3.880E-25	302	0.225	0.222	7ag6A.pdb.gz	Molecular Basis of Sulfosugar Selectivity in Sulfoglycolysis.
7	AFDB:P32143	0.847	0.847	2.163E-23	298	0.228	0.228	P32143.pdb.gz	SQUV_ECOLI Sulfofructose kinase OS=Escherichia coli (strain K12) OX=83333 GN=yihV PE=1 SV=2
8	AFDB:F4JM15	0.833	0.580	8.815E-23	440	0.242	0.164	F4JM15.pdb.gz	F4JM15_ARATH PfkB-like carbohydrate kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g28706 PE=1 SV=1
9	PDB:1gqtB	0.784	0.763	1.853E-22	307	0.191	0.186	1gqtB.pdb.gz	Activation of Ribokinase by Monovalent Cations.
10	PDB:5bycA	0.784	0.738	2.094E-22	318	0.198	0.186	5bycA.pdb.gz
11	AFDB:A1A6H3	0.799	0.641	3.179E-22	379	0.191	0.150	A1A6H3.pdb.gz	RBSK_ARATH Ribokinase OS=Arabidopsis thaliana OX=3702 GN=RBSK PE=1 SV=1
12	AFDB:P0A9J6	0.760	0.736	4.059E-22	309	0.185	0.178	P0A9J6.pdb.gz	RBSK_ECOLI Ribokinase OS=Escherichia coli (strain K12) OX=83333 GN=rbsK PE=1 SV=1
13	AFDB:Q387E8	0.787	0.712	5.508E-22	333	0.205	0.183	Q387E8.pdb.gz	Q387E8_TRYB2 Ribokinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0090 PE=3 SV=1
14	AFDB:P77493	0.839	0.797	7.946E-22	315	0.211	0.200	P77493.pdb.gz	YDJH_ECOLI Uncharacterized sugar kinase YdjH OS=Escherichia coli (strain K12) OX=83333 GN=ydjH PE=1 SV=2
15	AFDB:O60116	0.776	0.732	1.078E-21	318	0.134	0.126	O60116.pdb.gz	RBSK_SCHPO Ribokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rbk1 PE=3 SV=1
16	AFDB:Q8R1Q9	0.822	0.763	1.556E-21	323	0.198	0.183	Q8R1Q9.pdb.gz	RBSK_MOUSE Ribokinase OS=Mus musculus OX=10090 GN=Rbks PE=1 SV=1
17	PDB:3in1A	0.795	0.763	3.270E-21	312	0.201	0.192	3in1A.pdb.gz	Crystal structure of a putative Ribokinase in complex with ADP from E.coli
18	PDB:2c49A	0.722	0.720	1.601E-20	299	0.181	0.181	2c49A.pdb.gz	Structure of Methanocaldococcus Jannaschii Nucleoside Kinase: An Archaeal Member of the Ribokinase Family.
19	PDB:6c9rA	0.726	0.650	1.063E-19	337	0.181	0.160	6c9rA.pdb.gz	Structure-Guided Drug Design of 6-Substituted Adenosine Analogues as Potent Inhibitors of Mycobacterium tuberculosis Adenosine Kinase.
20	PDB:2varA	0.781	0.751	1.876E-18	311	0.171	0.164	2varA.pdb.gz	The Structure of Sulfolobus Solfataricus 2-Keto-3-Deoxygluconate Kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50053	0.0	613	298	1.000	1.000	KHK_HUMAN Ketohexokinase OS=Homo sapiens OX=9606 GN=KHK PE=1 SV=2
2	P97328	0.0	546	298	0.869	0.869	KHK_MOUSE Ketohexokinase OS=Mus musculus OX=10090 GN=Khk PE=1 SV=1
3	Q02974	0.0	545	298	0.866	0.866	KHK_RAT Ketohexokinase OS=Rattus norvegicus OX=10116 GN=Khk PE=1 SV=1
4	F4JM15	1.66e-16	81.6	440	0.262	0.177	F4JM15_ARATH PfkB-like carbohydrate kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At4g28706 PE=1 SV=1
5	P32143	8.79e-11	63.5	298	0.242	0.242	SQUV_ECOLI Sulfofructose kinase OS=Escherichia coli (strain K12) OX=83333 GN=yihV PE=1 SV=2
6	Q387E8	1.22e-09	60.5	333	0.242	0.216	Q387E8_TRYB2 Ribokinase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0090 PE=3 SV=1
7	P77493	1.38e-08	57.4	315	0.232	0.219	YDJH_ECOLI Uncharacterized sugar kinase YdjH OS=Escherichia coli (strain K12) OX=83333 GN=ydjH PE=1 SV=2
8	E9AD19	3.02e-08	56.2	329	0.225	0.204	RBSK_LEIMA Ribokinase OS=Leishmania major OX=5664 GN=LMJF_27_0420 PE=1 SV=1
9	Q57849	6.07e-07	52.4	302	0.201	0.199	NK_METJA Nucleoside kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0406 PE=1 SV=1
10	A1A6H3	1.02e-06	52.0	379	0.238	0.187	RBSK_ARATH Ribokinase OS=Arabidopsis thaliana OX=3702 GN=RBSK PE=1 SV=1
11	P78825	1.36e-06	51.2	340	0.221	0.194	ADK_SCHPO Adenosine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ado1 PE=2 SV=2
12	Q9LZG0	3.17e-04	44.3	345	0.232	0.200	ADK2_ARATH Adenosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
13	Q9SF85	0.001	42.4	344	0.218	0.189	ADK1_ARATH Adenosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=1
14	Q53W83	0.011	39.3	309	0.218	0.210	KDGK_THET8 2-dehydro-3-deoxygluconokinase OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=kdgK PE=1 SV=1
15	Q9HJT3	0.014	38.9	287	0.188	0.195	NK_THEAC Nucleoside kinase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0880 PE=1 SV=1
16	P45543	0.024	38.1	261	0.228	0.261	FRLD_ECOLI Fructoselysine 6-kinase OS=Escherichia coli (strain K12) OX=83333 GN=frlD PE=1 SV=1
17	Q9H477	0.087	36.6	322	0.191	0.177	RBSK_HUMAN Ribokinase OS=Homo sapiens OX=9606 GN=RBKS PE=1 SV=1
18	Q940Y6	0.091	36.6	471	0.188	0.119	Q940Y6_ARATH AT4g27600/T29A15_90 OS=Arabidopsis thaliana OX=3702 GN=NARA5 PE=1 SV=1
19	P45416	0.16	35.8	310	0.218	0.210	KDGK_DICD3 2-dehydro-3-deoxygluconokinase OS=Dickeya dadantii (strain 3937) OX=198628 GN=kdgK PE=1 SV=3
20	P9WID5	0.19	35.4	324	0.064	0.059	ADOK_MYCTU Adenosine kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=adoK PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00294 PfkB	8.4e-29	112.4	pfkB family carbohydrate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000005799

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007428	0.977	Belongs to the class I fructose-bisphosphate aldolase family
2	60711.ENSCSAP00000003520	0.960	Belongs to the class I fructose-bisphosphate aldolase family
3	60711.ENSCSAP00000002464	0.955	Belongs to the class I fructose-bisphosphate aldolase family
4	60711.ENSCSAP00000008557	0.878	Sucrase-isomaltase (alpha-glucosidase)
5	60711.ENSCSAP00000011150	0.696	Thioredoxin domain containing 16
6	60711.ENSCSAP00000008515	0.694	NIPA-like domain containing 2
7	60711.ENSCSAP00000002691	0.688	Triokinase and FMN cyclase
8	60711.ENSCSAP00000004209	0.678	Maltase-glucoamylase (alpha-glucosidase)
9	60711.ENSCSAP00000004191	0.674	Belongs to the glycosyl hydrolase 31 family.
10	60711.ENSCSAP00000011016	0.660	X-ray repair complementing defective repair in Chinese hamster cells 4
11	60711.ENSCSAP00000014662	0.649	MRE11 homolog, double strand break repair nuclease
12	60711.ENSCSAP00000010545	0.643	Homeobox D1
13	60711.ENSCSAP00000009092	0.639	Dynein, cytoplasmic 2, light intermediate chain 1
14	60711.ENSCSAP00000006296	0.611	Glucokinase (hexokinase 4) regulator
15	60711.ENSCSAP00000005669	0.606	Microtubule-associated protein, RP/EB family, member 3
16	60711.ENSCSAP00000017242	0.599	Solute carrier family 2 (facilitated glucose/fructose transporter), member 5
17	60711.ENSCSAP00000013919	0.595	Microtubule-associated protein, RP/EB family, member 2
18	60711.ENSCSAP00000005095	0.542	Villin 1
19	60711.ENSCSAP00000008713	0.542	Microtubule-associated protein, RP/EB family, member 1
20	60711.ENSCSAP00000018000	0.532	APC2, WNT signaling pathway regulator

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0019200	1.000	carbohydrate kinase activity
GO:0004454	0.979	ketohexokinase activity
GO:0005488	0.958	binding
GO:0005515	0.897	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0005975	0.989	carbohydrate metabolic process
GO:1901575	0.983	organic substance catabolic process
GO:0009987	0.976	cellular process
GO:0044281	0.967	small molecule metabolic process
GO:0019318	0.946	hexose metabolic process
GO:0044237	0.941	cellular metabolic process
GO:0016052	0.899	carbohydrate catabolic process
GO:0065007	0.729	biological regulation
GO:1901360	0.706	organic cyclic compound metabolic process
GO:0006725	0.706	cellular aromatic compound metabolic process
GO:0006796	0.699	phosphate-containing compound metabolic process
GO:0046483	0.696	heterocycle metabolic process
GO:0034641	0.696	cellular nitrogen compound metabolic process
GO:0016310	0.680	phosphorylation
GO:0019637	0.631	organophosphate metabolic process
GO:0006139	0.628	nucleobase-containing compound metabolic process
GO:1901135	0.616	carbohydrate derivative metabolic process
GO:0050794	0.575	regulation of cellular process
GO:0050896	0.571	response to stimulus
GO:1901564	0.520	organonitrogen compound metabolic process
GO:0072521	0.481	purine-containing compound metabolic process
GO:0055086	0.461	nucleobase-containing small molecule metabolic process
GO:0006753	0.414	nucleoside phosphate metabolic process
GO:0019222	0.404	regulation of metabolic process
GO:0006082	0.395	organic acid metabolic process
GO:0009259	0.376	ribonucleotide metabolic process
GO:0006096	0.336	glycolytic process
GO:0060255	0.319	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.996	membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0043229	0.988	intracellular organelle
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0005576	0.958	extracellular region
GO:0005634	0.957	nucleus
GO:0070062	0.890	extracellular exosome
GO:0012505	0.332	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:18145	0.979	ATP + beta-D-fructose = ADP + beta-D-fructose 1-phosphate + H(+)
EC:2.7.1.3	0.979	ketohexokinase.

[back to server]