StarFunc result for job id P50150

User Input

>input (75 residues)
MKEGMSNNSTTSISQARKAVEQLKMEACMDRVKVSQAAADLLAYCEAHVREDPLIIPVPA
SENPFREKKFFCTIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1APZ0	0.628	0.628	8.859E-10	75	1.000	1.000	B1APZ0.pdb.gz	B1APZ0_HUMAN Guanine nucleotide-binding protein subunit gamma OS=Homo sapiens OX=9606 GN=GNG4 PE=1 SV=1
2	AFDB:P59768	0.593	0.619	2.618E-8	71	0.720	0.761	P59768.pdb.gz	GBG2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 OS=Homo sapiens OX=9606 GN=GNG2 PE=1 SV=2
3	AFDB:G3V8K2	0.814	0.814	2.213E-7	75	0.693	0.693	G3V8K2.pdb.gz	G3V8K2_RAT Guanine nucleotide-binding protein subunit gamma OS=Rattus norvegicus OX=10116 GN=Gng3 PE=1 SV=1
4	PDB:3uzsG	0.555	0.602	2.599E-7	67	0.693	0.776	3uzsG.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
5	AFDB:P63077	0.639	0.677	2.971E-7	70	0.573	0.614	P63077.pdb.gz	GBG8_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 OS=Rattus norvegicus OX=10116 GN=Gng8 PE=2 SV=1
6	AFDB:G3V6P8	0.618	0.639	1.739E-6	72	0.520	0.542	G3V6P8.pdb.gz	G3V6P8_RAT Guanine nucleotide-binding protein subunit gamma OS=Rattus norvegicus OX=10116 GN=Gng12 PE=1 SV=1
7	AFDB:O60262	0.604	0.654	2.334E-6	68	0.547	0.603	O60262.pdb.gz	GBG7_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 OS=Homo sapiens OX=9606 GN=GNG7 PE=1 SV=1
8	AFDB:P63218	0.572	0.618	2.649E-5	68	0.413	0.456	P63218.pdb.gz	GBG5_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 OS=Homo sapiens OX=9606 GN=GNG5 PE=1 SV=3
9	PDB:7rycD	0.450	0.157	5.604E-5	263	0.533	0.152	7rycD.pdb.gz	The oxytocin signaling complex reveals a molecular switch for cation dependence.
10	AFDB:P50151	0.704	0.768	1.073E-4	68	0.440	0.485	P50151.pdb.gz	GBG10_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10 OS=Homo sapiens OX=9606 GN=GNG10 PE=1 SV=1
11	AFDB:P38040	0.577	0.610	9.762E-4	70	0.360	0.386	P38040.pdb.gz	GBG1_DROME Guanine nucleotide-binding protein subunit gamma-1 OS=Drosophila melanogaster OX=7227 GN=Ggamma1 PE=2 SV=1
12	AFDB:D4AAI1	0.552	0.557	1.051E-3	74	0.320	0.324	D4AAI1.pdb.gz	D4AAI1_RAT Guanine nucleotide-binding protein subunit gamma OS=Rattus norvegicus OX=10116 GN=Gngt1 PE=3 SV=1
13	PDB:1b9xB	0.533	0.576	6.706E-3	68	0.267	0.294	1b9xB.pdb.gz
14	PDB:7shfC	0.408	0.101	7.456E-1	400	0.187	0.035	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1APZ0	2.06e-51	156	75	1.000	1.000	B1APZ0_HUMAN Guanine nucleotide-binding protein subunit gamma OS=Homo sapiens OX=9606 GN=GNG4 PE=1 SV=1
2	P50150	2.06e-51	156	75	1.000	1.000	GBG4_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4 OS=Homo sapiens OX=9606 GN=GNG4 PE=1 SV=1
3	P59768	2.02e-37	121	71	0.733	0.775	GBG2_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 OS=Homo sapiens OX=9606 GN=GNG2 PE=1 SV=2
4	P63212	2.02e-37	121	71	0.733	0.775	GBG2_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 OS=Bos taurus OX=9913 GN=GNG2 PE=1 SV=2
5	P63213	2.02e-37	121	71	0.733	0.775	GBG2_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2 OS=Mus musculus OX=10090 GN=Gng2 PE=1 SV=2
6	Q15KE4	4.24e-36	117	71	0.720	0.761	Q15KE4_DANRE Guanine nucleotide-binding protein subunit gamma OS=Danio rerio OX=7955 GN=zgc:110302 PE=1 SV=1
7	G3V8K2	4.68e-32	107	75	0.693	0.693	G3V8K2_RAT Guanine nucleotide-binding protein subunit gamma OS=Rattus norvegicus OX=10116 GN=Gng3 PE=1 SV=1
8	P63214	4.68e-32	107	75	0.693	0.693	GBG3_BOVIN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 OS=Bos taurus OX=9913 GN=GNG3 PE=1 SV=1
9	P63215	4.68e-32	107	75	0.693	0.693	GBG3_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 OS=Homo sapiens OX=9606 GN=GNG3 PE=1 SV=1
10	P63216	4.68e-32	107	75	0.693	0.693	GBG3_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3 OS=Mus musculus OX=10090 GN=Gng3 PE=1 SV=1
11	P63077	5.28e-30	102	70	0.613	0.657	GBG8_RAT Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 OS=Rattus norvegicus OX=10116 GN=Gng8 PE=2 SV=1
12	P63078	5.28e-30	102	70	0.613	0.657	GBG8_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 OS=Mus musculus OX=10090 GN=Gng8 PE=3 SV=1
13	Q9UK08	3.19e-29	100	70	0.600	0.643	GBG8_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8 OS=Homo sapiens OX=9606 GN=GNG8 PE=1 SV=1
14	Q45QK6	1.41e-26	93.6	51	0.547	0.804	Q45QK6_RAT Guanine nucleotide-binding protein subunit gamma (Fragment) OS=Rattus norvegicus OX=10116 GN=Gng2 PE=2 SV=1
15	Q9UBI6	5.31e-25	90.1	72	0.520	0.542	GBG12_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12 OS=Homo sapiens OX=9606 GN=GNG12 PE=1 SV=3
16	O60262	5.69e-25	89.7	68	0.547	0.603	GBG7_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 OS=Homo sapiens OX=9606 GN=GNG7 PE=1 SV=1
17	Q61016	1.74e-24	88.6	68	0.520	0.574	GBG7_MOUSE Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 OS=Mus musculus OX=10090 GN=Gng7 PE=1 SV=2
18	G3V6P8	2.84e-24	88.2	72	0.507	0.528	G3V6P8_RAT Guanine nucleotide-binding protein subunit gamma OS=Rattus norvegicus OX=10116 GN=Gng12 PE=1 SV=1
19	A0A8I6GAY3	6.13e-23	88.2	196	0.507	0.194	A0A8I6GAY3_RAT Guanine nucleotide-binding protein subunit gamma OS=Rattus norvegicus OX=10116 GN=Gng12 PE=1 SV=1
20	P63218	5.85e-16	67.0	68	0.413	0.456	GBG5_HUMAN Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 OS=Homo sapiens OX=9606 GN=GNG5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03910 Adeno_PV	5e+02	10.8	Adenovirus minor core protein PV
2	PF01990 ATP-synt_F	1.3e+02	14.3	ATP synthase (F/14-kDa) subunit
3	PF00631 G-gamma	2.4e-14	64.4	GGL domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006075555.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006054361.1	0.996	Guanine nucleotide-binding protein subunit beta-4
2	89462.XP_006046527.1	0.995	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
3	89462.XP_006066950.1	0.995	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
4	89462.XP_006066020.1	0.989	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 19 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 26 samples with support for all annotated introns
5	89462.XP_006065904.1	0.988	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 13 samples with support for all annotated introns
6	89462.XP_006052253.1	0.958	Guanine nucleotide-binding protein G(k) subunit alpha
7	89462.XP_006059995.1	0.948	Guanine nucleotide-binding protein G(i) subunit alpha-1-like
8	89462.XP_006053355.1	0.921	Guanine nucleotide-binding protein G(i) subunit alpha-2
9	89462.XP_006049098.1	0.918	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns
10	89462.XP_006078378.1	0.915	Guanine nucleotide-binding protein G(T) subunit gamma-T1
11	89462.XP_006051146.1	0.911	Proteinase-activated receptor 1
12	89462.XP_006074472.1	0.909	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns
13	89462.XP_006073097.1	0.891	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
14	89462.XP_006043083.1	0.876	Guanine nucleotide-binding protein G(olf) subunit alpha isoform X1
15	89462.XP_006050942.1	0.865	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 26 samples with support for all annotated introns
16	89462.XP_006049957.1	0.863	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
17	89462.XP_006049890.1	0.857	Muscarinic acetylcholine receptor M2
18	89462.XP_006064567.1	0.857	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 19 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
19	89462.XP_006055032.1	0.854	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns
20	89462.XP_006061956.1	0.849	Guanine nucleotide-binding protein subunit alpha-13 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.863	catalytic activity
GO:0016787	0.318	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.970	cellular process
GO:0050896	0.969	response to stimulus
GO:0007165	0.957	signal transduction
GO:0048583	0.823	regulation of response to stimulus
GO:0023051	0.821	regulation of signaling
GO:0010646	0.821	regulation of cell communication
GO:0009966	0.788	regulation of signal transduction
GO:0008277	0.708	regulation of G protein-coupled receptor signaling pathway
GO:0040008	0.640	regulation of growth
GO:0051128	0.570	regulation of cellular component organization
GO:0007186	0.523	G protein-coupled receptor signaling pathway
GO:0048519	0.438	negative regulation of biological process
GO:0032501	0.420	multicellular organismal process
GO:0048523	0.405	negative regulation of cellular process
GO:0001558	0.386	regulation of cell growth

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.927	organelle
GO:0043227	0.923	membrane-bounded organelle
GO:0005576	0.904	extracellular region
GO:0031982	0.790	vesicle
GO:0005622	0.743	intracellular anatomical structure
GO:0005737	0.728	cytoplasm
GO:0005615	0.620	extracellular space
GO:1903561	0.551	extracellular vesicle
GO:0070062	0.476	extracellular exosome
GO:0005829	0.336	cytosol
GO:0043229	0.321	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.318	Hydrolases.

[back to server]