StarFunc result for job id P50213

User Input

>input (366 residues)
MAGPAWISKVSRLLGAFHNPKQVTRGFTGGVQTVTLIPGDGIGPEISAAVMKIFDAAKAP
IQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLKTPIAAGHPSMNLLLRKTFDL
YANVRPCVSIEGYKTPYTDVNIVTIRENTEGEYSGIEHVIVDGVVQSIKLITEGASKRIA
EFAFEYARNNHRSNVTAVHKANIMRMSDGLFLQKCREVAESCKDIKFNEMYLDTVCLNMV
QDPSQFDVLVMPNLYGDILSDLCAGLIGGLGVTPSGNIGANGVAIFESVHGTAPDIAGKD
MANPTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICR
RVKDLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50213	1.000	1.000	4.614E-75	366	1.000	1.000	P50213.pdb.gz	IDH3A_HUMAN Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1
2	PDB:6kdfE	0.896	0.970	5.279E-60	338	0.918	0.994	6kdfE.pdb.gz
3	AFDB:Q9VWH4	0.914	0.888	3.338E-56	377	0.672	0.653	Q9VWH4.pdb.gz	IDH3A_DROME Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Idh3a PE=2 SV=1
4	AFDB:Q93714	0.924	0.944	6.962E-56	358	0.686	0.701	Q93714.pdb.gz	IDH3A_CAEEL Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=idha-1 PE=3 SV=3
5	AFDB:H0YL72	0.812	0.895	1.861E-50	331	0.891	0.985	H0YL72.pdb.gz	H0YL72_HUMAN Isocitrate dehydrogenase (NAD(+)) 3 catalytic subunit alpha OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1
6	AFDB:Q945K7	0.902	0.884	4.415E-49	374	0.546	0.535	Q945K7.pdb.gz	IDH5_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH5 PE=1 SV=1
7	AFDB:Q8LG77	0.892	0.873	3.845E-47	374	0.527	0.516	Q8LG77.pdb.gz	IDH6_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH6 PE=1 SV=2
8	AFDB:Q9USP8	0.899	0.869	4.556E-47	379	0.574	0.554	Q9USP8.pdb.gz	IDH2_SCHPO Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idh2 PE=1 SV=2
9	AFDB:Q6FQD0	0.918	0.913	3.749E-45	368	0.533	0.530	Q6FQD0.pdb.gz	Q6FQD0_CANGA isocitrate dehydrogenase (NAD(+)) OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IDH2 PE=3 SV=1
10	AFDB:P28241	0.916	0.908	9.804E-45	369	0.522	0.518	P28241.pdb.gz	IDH2_YEAST Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDH2 PE=1 SV=1
11	AFDB:Q54B68	0.865	0.879	3.455E-43	360	0.462	0.469	Q54B68.pdb.gz	IDHB_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=idhB PE=3 SV=1
12	PDB:3blvH	0.866	0.909	4.864E-40	348	0.500	0.526	3blvH.pdb.gz	Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
13	PDB:7ce3B	0.862	0.913	3.843E-37	345	0.407	0.432	7ce3B.pdb.gz
14	PDB:3blvC	0.857	0.910	6.392E-37	344	0.437	0.465	3blvC.pdb.gz	Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
15	PDB:4yb4A	0.825	0.903	4.440E-35	333	0.361	0.396	4yb4A.pdb.gz	Structure of homoisocitrate dehydrogenase from Thermus thermophilus in complex with homoisocitrate, magnesium(II) and NADH
16	PDB:3ty3A	0.825	0.843	5.515E-32	358	0.355	0.363	3ty3A.pdb.gz	Crystal structure of homoisocitrate dehydrogenase from Schizosaccharomyces pombe.
17	PDB:1hqsA	0.821	0.713	1.168E-30	423	0.331	0.286	1hqsA.pdb.gz
18	PDB:4aj3A	0.819	0.724	1.736E-30	416	0.333	0.293	4aj3A.pdb.gz	Induced Fit and the Catalytic Mechanism of Isocitrate Dehydrogenase.
19	PDB:2g4oD	0.805	0.872	2.437E-30	337	0.306	0.332	2g4oD.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
20	PDB:2y42D	0.775	0.798	6.117E-29	355	0.314	0.324	2y42D.pdb.gz	Atomic Level Description of the Domain Closure in a Dimeric Enzyme: Thermus Thermophilus 3-Isopropylmalate Dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YL72	0.0	669	331	0.904	1.000	H0YL72_HUMAN Isocitrate dehydrogenase (NAD(+)) 3 catalytic subunit alpha OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1
2	P50213	0.0	759	366	1.000	1.000	IDH3A_HUMAN Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1
3	Q99NA5	0.0	742	366	0.973	0.973	IDH3A_RAT Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3a PE=1 SV=1
4	Q9D6R2	0.0	743	366	0.975	0.975	IDH3A_MOUSE Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Mus musculus OX=10090 GN=Idh3a PE=1 SV=1
5	Q9VWH4	6.54e-180	505	377	0.658	0.639	IDH3A_DROME Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Idh3a PE=2 SV=1
6	Q93714	2.87e-175	493	358	0.669	0.684	IDH3A_CAEEL Probable isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=idha-1 PE=3 SV=3
7	Q9USP8	6.28e-144	414	379	0.566	0.546	IDH2_SCHPO Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idh2 PE=1 SV=2
8	Q945K7	1.15e-141	408	374	0.525	0.513	IDH5_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH5 PE=1 SV=1
9	Q8LG77	3.78e-135	392	374	0.516	0.505	IDH6_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH6 PE=1 SV=2
10	Q6FQD0	4.34e-124	363	368	0.522	0.519	Q6FQD0_CANGA isocitrate dehydrogenase (NAD(+)) OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IDH2 PE=3 SV=1
11	H0YMU3	5.56e-123	353	175	0.478	1.000	H0YMU3_HUMAN Isocitrate dehydrogenase (NAD(+)) 3 catalytic subunit alpha (Fragment) OS=Homo sapiens OX=9606 GN=IDH3A PE=1 SV=1
12	P28241	1.24e-121	357	369	0.511	0.507	IDH2_YEAST Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDH2 PE=1 SV=1
13	Q54B68	7.86e-114	337	360	0.473	0.481	IDHB_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=idhB PE=3 SV=1
14	O81796	1.13e-104	314	368	0.459	0.457	IDH3_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH3 PE=1 SV=1
15	Q8LFC0	4.35e-104	312	367	0.443	0.441	IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH1 PE=1 SV=2
16	O13696	5.44e-104	312	356	0.462	0.475	IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idh1 PE=1 SV=1
17	P93032	1.52e-99	301	367	0.426	0.425	IDH2_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH2 PE=1 SV=2
18	A0A668KL51	2.93e-99	301	380	0.423	0.408	A0A668KL51_MOUSE Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Mus musculus OX=10090 GN=Idh3b PE=1 SV=1
19	P28834	1.71e-97	295	360	0.426	0.433	IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDH1 PE=1 SV=2
20	Q91VA7	2.09e-96	293	384	0.413	0.393	Q91VA7_MOUSE Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Mus musculus OX=10090 GN=Idh3b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00180 Iso_dh	2.3e-109	377.4	Isocitrate/isopropylmalate dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299518

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216254	0.999	Aconitate hydratase, mitochondrial
2	9606.ENSP00000217901	0.999	Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
3	9606.ENSP00000370223	0.999	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
4	9606.ENSP00000331897	0.998	Isocitrate dehydrogenase [NADP], mitochondrial
5	9606.ENSP00000390265	0.995	Isocitrate dehydrogenase 1, cytosolic
6	9606.ENSP00000342056	0.994	Citrate synthase, mitochondrial
7	9606.ENSP00000367923	0.994	Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial
8	9606.ENSP00000222673	0.988	2-oxoglutarate dehydrogenase, mitochondrial
9	9606.ENSP00000327070	0.984	Malate dehydrogenase, mitochondrial
10	9606.ENSP00000363216	0.980	2-oxoglutarate dehydrogenase-like, mitochondrial
11	9606.ENSP00000309477	0.970	Cytoplasmic aconitate hydratase
12	9606.ENSP00000377446	0.963	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
13	9606.ENSP00000203407	0.934	Cytochrome b-c1 complex subunit 1, mitochondrial
14	9606.ENSP00000277865	0.932	Glutamate dehydrogenase 1, mitochondrial
15	9606.ENSP00000446743	0.930	Uncharacterized protein
16	9606.ENSP00000355518	0.924	Fumarate hydratase, mitochondrial
17	9606.ENSP00000327589	0.921	Glutamate dehydrogenase 2, mitochondrial
18	9606.ENSP00000307241	0.919	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
19	9606.ENSP00000381736	0.914	ATP synthase subunit alpha, mitochondrial
20	9606.ENSP00000335304	0.908	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004449	1.000	isocitrate dehydrogenase (NAD+) activity
GO:0005488	0.999	binding
GO:0005515	0.994	protein binding
GO:0043167	0.895	ion binding
GO:0043169	0.670	cation binding
GO:0046872	0.606	metal ion binding
GO:0000287	0.527	magnesium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006091	0.995	generation of precursor metabolites and energy
GO:0009060	0.987	aerobic respiration
GO:0006099	0.984	tricarboxylic acid cycle
GO:0071704	0.976	organic substance metabolic process
GO:0044281	0.852	small molecule metabolic process
GO:0019752	0.779	carboxylic acid metabolic process
GO:0006807	0.699	nitrogen compound metabolic process
GO:1901564	0.640	organonitrogen compound metabolic process
GO:0034641	0.397	cellular nitrogen compound metabolic process
GO:1901360	0.362	organic cyclic compound metabolic process
GO:0046483	0.339	heterocycle metabolic process
GO:0006725	0.317	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0032991	0.985	protein-containing complex
GO:0098798	0.892	mitochondrial protein-containing complex
GO:1902494	0.888	catalytic complex
GO:0005759	0.888	mitochondrial matrix
GO:1990204	0.596	oxidoreductase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23632	1.000	D-threo-isocitrate + NAD(+) = 2-oxoglutarate + CO2 + NADH
EC:1.1.1.41	1.000	isocitrate dehydrogenase (NAD(+)).

[back to server]