StarFunc result for job id P50222

User Input

>input (304 residues)
MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPELSTSSSSCIIAGYPNEEGMF
ASQHHRGHHHHHHHHHHHHHQQQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPEL
GSSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEKRSGGKRKSDSSDSQEGNYK
SEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRM
KWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSIANEDSHDSDHSSE
HAHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50222	1.000	1.000	1.481E-43	304	1.000	1.000	P50222.pdb.gz	MEOX2_HUMAN Homeobox protein MOX-2 OS=Homo sapiens OX=9606 GN=MEOX2 PE=1 SV=2
2	AFDB:A8KBT9	0.201	0.224	2.949E-8	270	0.230	0.259	A8KBT9.pdb.gz	A8KBT9_DANRE Caudal type homeo box transcription factor 4 OS=Danio rerio OX=7955 GN=CHUNP6923 PE=2 SV=1
3	AFDB:B2RYB5	0.206	0.202	3.594E-8	313	0.191	0.185	B2RYB5.pdb.gz	B2RYB5_RAT Hoxa10 protein OS=Rattus norvegicus OX=10116 GN=Hoxa10 PE=2 SV=1
4	AFDB:A2RU54	0.234	0.260	4.379E-8	273	0.204	0.227	A2RU54.pdb.gz	HMX2_HUMAN Homeobox protein HMX2 OS=Homo sapiens OX=9606 GN=HMX2 PE=2 SV=1
5	AFDB:Q9QZW9	0.220	0.168	6.944E-8	404	0.266	0.200	Q9QZW9.pdb.gz	MNX1_MOUSE Motor neuron and pancreas homeobox protein 1 OS=Mus musculus OX=10090 GN=Mnx1 PE=1 SV=2
6	AFDB:Q01703	0.210	0.232	7.922E-8	273	0.201	0.223	Q01703.pdb.gz	MSXC_DANRE Homeobox protein MSH-C OS=Danio rerio OX=7955 GN=msxc PE=2 SV=1
7	AFDB:P31268	0.224	0.290	1.176E-7	230	0.204	0.270	P31268.pdb.gz	HXA7_HUMAN Homeobox protein Hox-A7 OS=Homo sapiens OX=9606 GN=HOXA7 PE=1 SV=3
8	AFDB:Q15699	0.229	0.215	1.176E-7	326	0.181	0.169	Q15699.pdb.gz	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
9	AFDB:Q9YH70	0.231	0.212	1.635E-7	334	0.240	0.219	Q9YH70.pdb.gz	Q9YH70_XENLA VENT homeobox 2, gene 2 S homeolog OS=Xenopus laevis OX=8355 GN=ventx2.2.S PE=4 SV=1
10	AFDB:Q99626	0.204	0.199	3.374E-7	313	0.181	0.176	Q99626.pdb.gz	CDX2_HUMAN Homeobox protein CDX-2 OS=Homo sapiens OX=9606 GN=CDX2 PE=1 SV=3
11	PDB:4egcA	0.170	0.096	9.802E-3	539	0.049	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.167	0.620	1.276E-2	73	0.056	0.233	2hi3A.pdb.gz
13	PDB:7fbyA	0.134	0.242	9.228E-1	153	0.033	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5aj0BZ	0.137	0.411	1.053	86	0.036	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:7dcoL	0.124	0.090	2.034	435	0.069	0.048	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
16	PDB:6v7wE	0.120	0.153	2.647	234	0.039	0.051	6v7wE.pdb.gz	A phage-encoded anti-activator inhibits quorum sensing in Pseudomonas aeruginosa.
17	PDB:2vbwA	0.122	0.228	2.828	147	0.043	0.088	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
18	PDB:2cg4A	0.120	0.222	3.226	149	0.023	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
19	PDB:2cjjA	0.167	0.685	3.226	63	0.033	0.159	2cjjA.pdb.gz
20	PDB:2h09A	0.084	0.183	3.445	127	0.023	0.055	2h09A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P32443	0.0	608	303	0.977	0.980	MEOX2_MOUSE Homeobox protein MOX-2 OS=Mus musculus OX=10090 GN=Meox2 PE=1 SV=1
2	P50222	0.0	624	304	1.000	1.000	MEOX2_HUMAN Homeobox protein MOX-2 OS=Homo sapiens OX=9606 GN=MEOX2 PE=1 SV=2
3	Q6FHY5	0.0	615	303	0.993	0.997	Q6FHY5_HUMAN MEOX2 protein OS=Homo sapiens OX=9606 GN=MEOX2 PE=1 SV=1
4	F1Q4R9	1.97e-58	189	253	0.368	0.443	MEOX1_DANRE Homeobox protein MOX-1 OS=Danio rerio OX=7955 GN=meox1 PE=2 SV=1
5	P50221	4.94e-56	183	254	0.398	0.476	MEOX1_HUMAN Homeobox protein MOX-1 OS=Homo sapiens OX=9606 GN=MEOX1 PE=1 SV=1
6	P32442	5.64e-53	176	253	0.368	0.443	MEOX1_MOUSE Homeobox protein MOX-1 OS=Mus musculus OX=10090 GN=Meox1 PE=1 SV=1
7	P09629	3.58e-21	91.7	217	0.148	0.207	HXB7_HUMAN Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4
8	Q9VSC2	4.29e-21	95.5	525	0.135	0.078	Q9VSC2_DROME Extra-extra OS=Drosophila melanogaster OX=7227 GN=exex PE=2 SV=1
9	P09024	1.16e-20	90.1	217	0.155	0.217	HXB7_MOUSE Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=1 SV=2
10	P31264	2.22e-20	93.6	782	0.181	0.070	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
11	Q6SYZ1	5.83e-20	90.1	311	0.135	0.132	Q6SYZ1_DANRE Homeodomain protein Hb9 OS=Danio rerio OX=7955 GN=hb9 PE=2 SV=1
12	A2CEW5	1.14e-19	89.4	320	0.135	0.128	A2CEW5_DANRE Motor neuron and pancreas homeobox 2b OS=Danio rerio OX=7955 GN=hlxb9lb PE=4 SV=1
13	B3DHA2	1.19e-19	89.4	309	0.148	0.146	B3DHA2_DANRE Homeo box HB9 like a OS=Danio rerio OX=7955 GN=hlxb9la PE=2 SV=1
14	F1RCJ6	1.35e-19	89.4	328	0.135	0.125	F1RCJ6_DANRE Motor neuron and pancreas homeobox 2b OS=Danio rerio OX=7955 GN=hlxb9lb PE=4 SV=1
15	P50219	1.56e-19	90.1	401	0.132	0.100	MNX1_HUMAN Motor neuron and pancreas homeobox protein 1 OS=Homo sapiens OX=9606 GN=MNX1 PE=1 SV=3
16	P06798	1.88e-19	88.2	285	0.135	0.144	HXA4_MOUSE Homeobox protein Hox-A4 OS=Mus musculus OX=10090 GN=Hoxa4 PE=2 SV=4
17	Q9QZW9	1.94e-19	89.7	404	0.132	0.099	MNX1_MOUSE Motor neuron and pancreas homeobox protein 1 OS=Mus musculus OX=10090 GN=Mnx1 PE=1 SV=2
18	M0R6D8	2.14e-19	89.7	403	0.132	0.099	MNX1_RAT Motor neuron and pancreas homeobox 1 OS=Rattus norvegicus OX=10116 GN=Mnx1 PE=3 SV=2
19	Q08624	2.44e-19	87.8	264	0.118	0.136	HXC4_MOUSE Homeobox protein Hox-C4 OS=Mus musculus OX=10090 GN=Hoxc4 PE=2 SV=1
20	Q86TF7	2.73e-19	87.4	264	0.118	0.136	Q86TF7_HUMAN Homeobox C4 OS=Homo sapiens OX=9606 GN=HOXC4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	3.8e-19	79.6	Homeodomain
2	PF09726 Macoilin	27	14.8	Macoilin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262041

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322242	0.782	RING finger protein 10
2	9606.ENSP00000265354	0.767	Serum response factor
3	9606.ENSP00000246080	0.751	Transcription factor 15
4	9606.ENSP00000321684	0.719	Homeobox protein MOX-1
5	9606.ENSP00000362390	0.609	T-box transcription factor TBX22
6	9606.ENSP00000224073	0.592	Endothelial differentiation-related factor 1
7	9606.ENSP00000333640	0.586	Eyes absent homolog 2
8	9606.ENSP00000401678	0.566	Myocardin
9	9606.ENSP00000454157	0.557	Zinc finger E-box-binding homeobox 2
10	9606.ENSP00000362410	0.544	Transcription factor MafB
11	9606.ENSP00000354476	0.543	Sterol regulatory element-binding protein 2
12	9606.ENSP00000381499	0.536	Paired box protein Pax-1
13	9606.ENSP00000263816	0.523	Low-density lipoprotein receptor-related protein 2
14	9606.ENSP00000341662	0.514	Alkylglycerol monooxygenase
15	9606.ENSP00000250003	0.509	Myoblast determination protein 1
16	9606.ENSP00000228644	0.505	Myogenic factor 5
17	9606.ENSP00000414657	0.501	Protein odd-skipped-related 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.986	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.985	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.984	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.993	developmental process
GO:0050794	0.989	regulation of cellular process
GO:0032501	0.981	multicellular organismal process
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0048856	0.978	anatomical structure development
GO:0010468	0.972	regulation of gene expression
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0009889	0.965	regulation of biosynthetic process
GO:0010556	0.962	regulation of macromolecule biosynthetic process
GO:0019219	0.961	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.951	regulation of RNA biosynthetic process
GO:0048518	0.925	positive regulation of biological process
GO:0006355	0.923	regulation of DNA-templated transcription
GO:0007275	0.864	multicellular organism development
GO:0048522	0.822	positive regulation of cellular process
GO:0051173	0.818	positive regulation of nitrogen compound metabolic process
GO:0010604	0.814	positive regulation of macromolecule metabolic process
GO:0009987	0.801	cellular process
GO:0048513	0.732	animal organ development
GO:0031325	0.726	positive regulation of cellular metabolic process
GO:0045935	0.716	positive regulation of nucleobase-containing compound metabolic process
GO:0048519	0.695	negative regulation of biological process
GO:0051254	0.695	positive regulation of RNA metabolic process
GO:0006357	0.694	regulation of transcription by RNA polymerase II
GO:0045893	0.691	positive regulation of DNA-templated transcription
GO:0045944	0.657	positive regulation of transcription by RNA polymerase II
GO:0048523	0.644	negative regulation of cellular process
GO:0048731	0.569	system development
GO:0009888	0.415	tissue development
GO:0050896	0.413	response to stimulus
GO:0009653	0.375	anatomical structure morphogenesis
GO:0007389	0.360	pattern specification process
GO:0051239	0.329	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.992	cytoplasm
GO:0005654	0.969	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]