StarFunc result for job id P50226

User Input

>input (295 residues)
MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDM
IYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLD
QKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWW
ELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNY
TTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DMM9	0.987	0.987	4.361E-55	295	0.902	0.902	P0DMM9.pdb.gz	ST1A3_HUMAN Sulfotransferase 1A3 OS=Homo sapiens OX=9606 GN=SULT1A3 PE=1 SV=1
2	PDB:3u3kA	0.973	0.993	3.721E-52	289	0.936	0.955	3u3kA.pdb.gz	The molecular basis for the broad substrate specificity of human sulfotransferase 1A1.
3	AFDB:P17988	0.980	0.993	1.946E-50	291	0.769	0.780	P17988.pdb.gz	ST1A1_RAT Sulfotransferase 1A1 OS=Rattus norvegicus OX=10116 GN=Sult1a1 PE=1 SV=1
4	AFDB:P52840	0.979	0.993	7.591E-48	291	0.725	0.735	P52840.pdb.gz	ST1A1_MOUSE Sulfotransferase 1A1 OS=Mus musculus OX=10090 GN=Sult1a1 PE=1 SV=1
5	AFDB:Q3UZZ6	0.984	0.984	9.395E-44	295	0.597	0.597	Q3UZZ6.pdb.gz	ST1D1_MOUSE Sulfotransferase 1 family member D1 OS=Mus musculus OX=10090 GN=Sult1d1 PE=1 SV=1
6	AFDB:Q8JG30	0.982	0.979	1.242E-43	296	0.539	0.537	Q8JG30.pdb.gz	ST1B1_CHICK Sulfotransferase 1B1 OS=Gallus gallus OX=9031 GN=SULT1B1 PE=1 SV=1
7	AFDB:Q9QWG7	0.982	0.969	2.098E-41	299	0.536	0.528	Q9QWG7.pdb.gz	ST1B1_MOUSE Sulfotransferase 1B1 OS=Mus musculus OX=10090 GN=Sult1b1 PE=1 SV=2
8	AFDB:P52847	0.984	0.971	2.773E-41	299	0.532	0.525	P52847.pdb.gz	ST1B1_RAT Sulfotransferase 1B1 OS=Rattus norvegicus OX=10116 GN=Sult1b1 PE=1 SV=2
9	AFDB:Q3T0Y3	0.973	0.970	3.278E-41	296	0.522	0.520	Q3T0Y3.pdb.gz	ST1B1_BOVIN Sulfotransferase 1B1 OS=Bos taurus OX=9913 GN=SULT1B1 PE=1 SV=1
10	PDB:2zytX	0.967	0.980	3.672E-41	291	0.593	0.601	2zytX.pdb.gz	Snapshot of a Michaelis complex in a sulfuryl transfer reaction: Crystal structure of a mouse sulfotransferase, mSULT1D1, complexed with donor substrate and accepter substrate
11	AFDB:Q95JD5	0.974	0.971	4.843E-41	296	0.542	0.541	Q95JD5.pdb.gz	ST1B1_CANLF Sulfotransferase 1B1 OS=Canis lupus familiaris OX=9615 GN=SULT1B1 PE=1 SV=1
12	AFDB:Q9WUW9	0.976	0.973	6.401E-41	296	0.542	0.541	Q9WUW9.pdb.gz	S1C2A_RAT Sulfotransferase 1C2A OS=Rattus norvegicus OX=10116 GN=Sult1c2a PE=1 SV=2
13	PDB:3cklB	0.974	0.971	1.655E-40	296	0.536	0.534	3cklB.pdb.gz	Crystal structure of human cytosolic sulfotransferase SULT1B1 in complex with PAP and resveratrol.
14	PDB:4jvlA	0.947	0.956	9.382E-37	292	0.488	0.493	4jvlA.pdb.gz	Mimicking of Estradiol Binding by Flame Retardants and Their Metabolites: A Crystallographic Analysis.
15	PDB:2gwhB	0.927	0.949	1.032E-35	288	0.532	0.545	2gwhB.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
16	PDB:1aqyA	0.908	0.946	7.556E-34	283	0.464	0.484	1aqyA.pdb.gz	Crystal structure of estrogen sulphotransferase.
17	PDB:1cjmA	0.735	0.967	3.960E-32	223	0.692	0.915	1cjmA.pdb.gz
18	PDB:3bfxA	0.827	0.961	2.947E-31	253	0.451	0.526	3bfxA.pdb.gz	Crystal Structures of Human Sulfotransferases Sult1B1 and Sult1C1 Complexed with the Cofactor Product Adenosine-3'-5'-Diphosphate (Pap).
19	PDB:2h8kA	0.770	0.922	1.607E-28	245	0.468	0.563	2h8kA.pdb.gz	Structural and chemical profiling of the human cytosolic sulfotransferases.
20	PDB:1q1qA	0.873	0.925	4.635E-28	278	0.353	0.374	1q1qA.pdb.gz	Crystal structure of human cholesterol sulfotransferase (SULT2B1b) in the presence of pregnenolone and 3'-phosphoadenosine 5'-phosphate. Rationale for specificity differences between prototypical SULT2A1 and the SULT2BG1 isoforms.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DMM9	0.0	561	295	0.902	0.902	ST1A3_HUMAN Sulfotransferase 1A3 OS=Homo sapiens OX=9606 GN=SULT1A3 PE=1 SV=1
2	P0DMN0	0.0	561	295	0.902	0.902	ST1A4_HUMAN Sulfotransferase 1A4 OS=Homo sapiens OX=9606 GN=SULT1A4 PE=1 SV=1
3	P50225	0.0	593	295	0.956	0.956	ST1A1_HUMAN Sulfotransferase 1A1 OS=Homo sapiens OX=9606 GN=SULT1A1 PE=1 SV=3
4	P50226	0.0	617	295	1.000	1.000	ST1A2_HUMAN Sulfotransferase 1A2 OS=Homo sapiens OX=9606 GN=SULT1A2 PE=1 SV=2
5	P17988	4.75e-168	469	291	0.769	0.780	ST1A1_RAT Sulfotransferase 1A1 OS=Rattus norvegicus OX=10116 GN=Sult1a1 PE=1 SV=1
6	P52840	1.41e-158	445	291	0.725	0.735	ST1A1_MOUSE Sulfotransferase 1A1 OS=Mus musculus OX=10090 GN=Sult1a1 PE=1 SV=1
7	Q3UZZ6	5.21e-136	388	295	0.593	0.593	ST1D1_MOUSE Sulfotransferase 1 family member D1 OS=Mus musculus OX=10090 GN=Sult1d1 PE=1 SV=1
8	Q8JG30	9.34e-125	360	296	0.536	0.534	ST1B1_CHICK Sulfotransferase 1B1 OS=Gallus gallus OX=9031 GN=SULT1B1 PE=1 SV=1
9	Q95JD5	1.45e-123	357	296	0.542	0.541	ST1B1_CANLF Sulfotransferase 1B1 OS=Canis lupus familiaris OX=9615 GN=SULT1B1 PE=1 SV=1
10	O43704	1.81e-120	348	296	0.536	0.534	ST1B1_HUMAN Sulfotransferase 1B1 OS=Homo sapiens OX=9606 GN=SULT1B1 PE=1 SV=2
11	Q3T0Y3	2.59e-120	348	296	0.522	0.520	ST1B1_BOVIN Sulfotransferase 1B1 OS=Bos taurus OX=9913 GN=SULT1B1 PE=1 SV=1
12	Q9QWG7	9.25e-120	347	299	0.536	0.528	ST1B1_MOUSE Sulfotransferase 1B1 OS=Mus musculus OX=10090 GN=Sult1b1 PE=1 SV=2
13	Q9WUW8	3.49e-119	345	296	0.549	0.547	ST1C2_RAT Sulfotransferase 1C2 OS=Rattus norvegicus OX=10116 GN=Sult1c2 PE=1 SV=2
14	O75897	1.24e-118	344	302	0.536	0.523	ST1C4_HUMAN Sulfotransferase 1C4 OS=Homo sapiens OX=9606 GN=SULT1C4 PE=1 SV=2
15	Q9WUW9	2.76e-118	343	296	0.542	0.541	S1C2A_RAT Sulfotransferase 1C2A OS=Rattus norvegicus OX=10116 GN=Sult1c2a PE=1 SV=2
16	Q9D939	1.55e-117	341	296	0.542	0.541	ST1C2_MOUSE Sulfotransferase 1C2 OS=Mus musculus OX=10090 GN=Sult1c2 PE=1 SV=1
17	A0A2K5X3B6	6.60e-117	340	302	0.525	0.513	ST1C4_MACFA Sulfotransferase 1C4 OS=Macaca fascicularis OX=9541 GN=SULT1C4 PE=1 SV=3
18	Q80VR3	2.31e-113	331	304	0.512	0.497	ST1C1_MOUSE Sulfotransferase 1C1 OS=Mus musculus OX=10090 GN=Sult1c1 PE=1 SV=1
19	O46503	2.32e-113	331	296	0.519	0.517	ST1C2_RABIT Sulfotransferase 1C2 OS=Oryctolagus cuniculus OX=9986 GN=SULT1C2 PE=1 SV=1
20	O00338	3.43e-113	330	296	0.522	0.520	ST1C2_HUMAN Sulfotransferase 1C2 OS=Homo sapiens OX=9606 GN=SULT1C2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00685 Sulfotransfer_1	2.6e-81	284.6	Sulfotransferase domain
2	PF13469 Sulfotransfer_3	4.4e-06	38.8	Sulfotransferase family
3	PF00804 Syntaxin	1.9e+02	13.1	Syntaxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378992

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378972	0.994	Sulfotransferase 1A1
2	9606.ENSP00000342007	0.937	Cytochrome P450 1A2
3	9606.ENSP00000360372	0.934	Cytochrome P450 2C19
4	9606.ENSP00000478561	0.931	Cytochrome P450 1B1
5	9606.ENSP00000301141	0.928	Cytochrome P450 2A6
6	9606.ENSP00000419970	0.918	NADPH--cytochrome P450 reductase
7	9606.ENSP00000450980	0.904	Responsible for the deiodination of T4 (3,5,3',5'- tetraiodothyronine)
8	9606.ENSP00000306606	0.902	Alcohol dehydrogenase 1B, beta polypeptide
9	9606.ENSP00000333212	0.902	Cytochrome P450 2U1
10	9606.ENSP00000354643	0.902	Type I iodothyronine deiodinase
11	9606.ENSP00000378359	0.902	Alcohol dehydrogenase 6
12	9606.ENSP00000308032	0.901	Cytochrome P450 2S1
13	9606.ENSP00000360968	0.901	Cytochrome P450 family 4 subfamily X member 1
14	9606.ENSP00000378570	0.885	Sulfotransferase 1A3
15	9606.ENSP00000347739	0.801	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs
16	9606.ENSP00000359539	0.736	Aspartate aminotransferase, cytoplasmic
17	9606.ENSP00000332565	0.660	Sulfotransferase 4A1
18	9606.ENSP00000319622	0.634	Sulfotransferase 1C2
19	9606.ENSP00000272452	0.621	Sulfotransferase 1C4
20	9606.ENSP00000217961	0.600	Steryl-sulfatase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004062	0.999	aryl sulfotransferase activity
GO:0005515	0.998	protein binding
GO:0043167	0.806	ion binding
GO:0097159	0.796	organic cyclic compound binding
GO:0043168	0.718	anion binding
GO:1901363	0.699	heterocyclic compound binding
GO:0036094	0.660	small molecule binding
GO:1901265	0.631	nucleoside phosphate binding
GO:1901681	0.361	sulfur compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.988	cellular metabolic process
GO:0071704	0.985	organic substance metabolic process
GO:0044238	0.979	primary metabolic process
GO:0050896	0.974	response to stimulus
GO:0071466	0.960	cellular response to xenobiotic stimulus
GO:0051923	0.950	sulfation
GO:1901360	0.924	organic cyclic compound metabolic process
GO:0006807	0.923	nitrogen compound metabolic process
GO:1901615	0.900	organic hydroxy compound metabolic process
GO:1901564	0.896	organonitrogen compound metabolic process
GO:0006066	0.863	alcohol metabolic process
GO:0043436	0.847	oxoacid metabolic process
GO:0006805	0.812	xenobiotic metabolic process
GO:0006725	0.807	cellular aromatic compound metabolic process
GO:0033875	0.742	ribonucleoside bisphosphate metabolic process
GO:0034032	0.720	purine nucleoside bisphosphate metabolic process
GO:1901616	0.705	organic hydroxy compound catabolic process
GO:0019693	0.705	ribose phosphate metabolic process
GO:0009259	0.667	ribonucleotide metabolic process
GO:0009150	0.628	purine ribonucleotide metabolic process
GO:0034308	0.622	primary alcohol metabolic process
GO:0006629	0.601	lipid metabolic process
GO:0065007	0.576	biological regulation
GO:0044282	0.481	small molecule catabolic process
GO:0008202	0.470	steroid metabolic process
GO:0042445	0.405	hormone metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0012505	0.350	endomembrane system
GO:0016020	0.312	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12164	0.999	3'-phosphoadenylyl sulfate + a phenol = adenosine 3',5'-bisphosphate + an aryl sulfate + H(+)
EC:2.8.2.1	0.999	aryl sulfotransferase.

[back to server]