StarFunc result for job id P50281

User Input

>input (582 residues)
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50281	1.000	1.000	0.000	582	1.000	1.000	P50281.pdb.gz	MMP14_HUMAN Matrix metalloproteinase-14 OS=Homo sapiens OX=9606 GN=MMP14 PE=1 SV=3
2	AFDB:B0R0I1	0.793	0.745	2.197E-88	621	0.670	0.628	B0R0I1.pdb.gz	B0R0I1_DANRE Matrix metallopeptidase 14b (membrane-inserted) OS=Danio rerio OX=7955 GN=MT-MMPbeta PE=1 SV=1
3	AFDB:F1Q899	0.760	0.770	2.609E-88	574	0.675	0.685	F1Q899.pdb.gz
4	AFDB:P51511	0.770	0.671	3.504E-79	669	0.581	0.505	P51511.pdb.gz	MMP15_HUMAN Matrix metalloproteinase-15 OS=Homo sapiens OX=9606 GN=MMP15 PE=1 SV=1
5	AFDB:O35548	0.438	0.420	8.761E-79	607	0.553	0.530	O35548.pdb.gz	MMP16_RAT Matrix metalloproteinase-16 OS=Rattus norvegicus OX=10116 GN=Mmp16 PE=2 SV=1
6	AFDB:D3ZCG5	0.773	0.686	4.883E-78	657	0.581	0.514	D3ZCG5.pdb.gz	D3ZCG5_RAT Matrix metallopeptidase 15 OS=Rattus norvegicus OX=10116 GN=Mmp15 PE=3 SV=1
7	AFDB:Q9Y5R2	0.414	0.374	2.690E-76	645	0.562	0.507	Q9Y5R2.pdb.gz	MMP24_HUMAN Matrix metalloproteinase-24 OS=Homo sapiens OX=9606 GN=MMP24 PE=2 SV=1
8	AFDB:Q3U435	0.407	0.386	4.226E-56	615	0.354	0.335	Q3U435.pdb.gz	MMP25_MOUSE Matrix metalloproteinase-25 OS=Mus musculus OX=10090 GN=Mmp25 PE=2 SV=1
9	AFDB:E7F1N5	0.409	0.416	2.610E-54	573	0.381	0.387	E7F1N5.pdb.gz	E7F1N5_DANRE Matrix metallopeptidase 25b OS=Danio rerio OX=7955 GN=mmp25b PE=3 SV=1
10	AFDB:Q9NPA2	0.405	0.419	3.476E-54	562	0.357	0.370	Q9NPA2.pdb.gz	MMP25_HUMAN Matrix metalloproteinase-25 OS=Homo sapiens OX=9606 GN=MMP25 PE=1 SV=1
11	PDB:1su3B	0.598	0.813	1.063E-44	416	0.294	0.411	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
12	PDB:1gxdA	0.606	0.568	9.908E-39	624	0.313	0.292	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
13	PDB:2mzeA	0.347	0.762	8.290E-19	250	0.179	0.416	2mzeA.pdb.gz	Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
14	PDB:3lp9A	0.289	0.700	2.816E-10	227	0.064	0.163	3lp9A.pdb.gz	Crystal structure and functional insights of hemopexin fold protein from grass pea
15	PDB:1aklA	0.213	0.260	2.137E-6	470	0.064	0.079	1aklA.pdb.gz	Crystal structure of the unliganded alkaline protease from Pseudomonas aeruginosa IFO3080 and its conformational changes on ligand binding.
16	PDB:5c2vB	0.189	0.282	2.262E-6	352	0.034	0.057	5c2vB.pdb.gz	The inner workings of the hydrazine synthase multiprotein complex.
17	PDB:1af0A	0.204	0.249	2.845E-6	470	0.064	0.079	1af0A.pdb.gz	Kinetic characterization of the serralysins: a divergent catalytic mechanism pertaining to astacin-type metalloproteases.
18	PDB:7fikF	0.185	0.292	5.044E-6	326	0.033	0.058	7fikF.pdb.gz
19	PDB:5yzgs	0.189	0.271	5.341E-6	374	0.029	0.045	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:4v6iAa	0.199	0.316	1.003E-5	319	0.046	0.085	4v6iAa.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0R0I1	0.0	803	621	0.674	0.631	B0R0I1_DANRE Matrix metallopeptidase 14b (membrane-inserted) OS=Danio rerio OX=7955 GN=MT-MMPbeta PE=1 SV=1
2	D3ZCG5	0.0	624	657	0.562	0.498	D3ZCG5_RAT Matrix metallopeptidase 15 OS=Rattus norvegicus OX=10116 GN=Mmp15 PE=3 SV=1
3	O35548	0.0	665	607	0.552	0.529	MMP16_RAT Matrix metalloproteinase-16 OS=Rattus norvegicus OX=10116 GN=Mmp16 PE=2 SV=1
4	P50281	0.0	1209	582	1.000	1.000	MMP14_HUMAN Matrix metalloproteinase-14 OS=Homo sapiens OX=9606 GN=MMP14 PE=1 SV=3
5	P51511	0.0	634	669	0.569	0.495	MMP15_HUMAN Matrix metalloproteinase-15 OS=Homo sapiens OX=9606 GN=MMP15 PE=1 SV=1
6	P51512	0.0	667	607	0.555	0.532	MMP16_HUMAN Matrix metalloproteinase-16 OS=Homo sapiens OX=9606 GN=MMP16 PE=1 SV=2
7	P53690	0.0	1169	582	0.966	0.966	MMP14_MOUSE Matrix metalloproteinase-14 OS=Mus musculus OX=10090 GN=Mmp14 PE=2 SV=3
8	Q10739	0.0	1176	582	0.967	0.967	MMP14_RAT Matrix metalloproteinase-14 OS=Rattus norvegicus OX=10116 GN=Mmp14 PE=2 SV=2
9	Q7T2J1	0.0	801	621	0.674	0.631	Q7T2J1_DANRE Matrix metalloproteinase-14 precursor OS=Danio rerio OX=7955 GN=MT-MMPbeta PE=2 SV=1
10	Q7T2J2	0.0	773	574	0.643	0.652	Q7T2J2_DANRE Matrix metalloproteinase 14 (Membrane-inserted) alpha OS=Danio rerio OX=7955 GN=wu:fb72b09 PE=2 SV=1
11	Q99PW6	0.0	615	618	0.541	0.510	MMP24_RAT Matrix metalloproteinase-24 OS=Rattus norvegicus OX=10116 GN=Mmp24 PE=1 SV=1
12	Q9R0S2	0.0	616	618	0.541	0.510	MMP24_MOUSE Matrix metalloproteinase-24 OS=Mus musculus OX=10090 GN=Mmp24 PE=1 SV=2
13	Q9WTR0	0.0	668	607	0.557	0.534	MMP16_MOUSE Matrix metalloproteinase-16 OS=Mus musculus OX=10090 GN=Mmp16 PE=2 SV=3
14	Q9Y5R2	0.0	628	645	0.545	0.491	MMP24_HUMAN Matrix metalloproteinase-24 OS=Homo sapiens OX=9606 GN=MMP24 PE=2 SV=1
15	E7F1N5	8.60e-114	352	573	0.400	0.407	E7F1N5_DANRE Matrix metallopeptidase 25b OS=Danio rerio OX=7955 GN=mmp25b PE=3 SV=1
16	Q3U435	3.02e-113	352	615	0.351	0.332	MMP25_MOUSE Matrix metalloproteinase-25 OS=Mus musculus OX=10090 GN=Mmp25 PE=2 SV=1
17	Q9NPA2	3.02e-110	343	562	0.359	0.372	MMP25_HUMAN Matrix metalloproteinase-25 OS=Homo sapiens OX=9606 GN=MMP25 PE=1 SV=1
18	Q9R0S3	1.85e-107	336	578	0.345	0.348	MMP17_MOUSE Matrix metalloproteinase-17 OS=Mus musculus OX=10090 GN=Mmp17 PE=1 SV=3
19	Q9ULZ9	2.59e-106	334	603	0.332	0.320	MMP17_HUMAN Matrix metalloproteinase-17 OS=Homo sapiens OX=9606 GN=MMP17 PE=1 SV=4
20	A0A0B4JDA7	5.36e-106	332	554	0.366	0.384	A0A0B4JDA7_DROME Matrix metalloproteinase 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	5.5	18.1	Astacin (Peptidase family M12A)
2	PF11857 DUF3377	3.1e-21	86.4	Domain of unknown function (DUF3377)
3	PF16313 DUF4953	98	13.6	Met-zincin
4	PF00045 Hemopexin	4.4e-53	188.3	Hemopexin
5	PF12728 HTH_17	2.5e+02	13.3	Helix-turn-helix domain
6	PF12044 Metallopep	48	14.0	Putative peptidase family
7	PF00413 Peptidase_M10	3e-56	201.1	Matrixin
8	PF07998 Peptidase_M54	72	14.8	Peptidase family M54
9	PF10462 Peptidase_M66	4.1e+02	11.3	Peptidase M66
10	PF01471 PG_binding_1	6.4e-08	44.0	Putative peptidoglycan binding domain
11	PF13582 Reprolysin_3	4.3e+02	12.8	Metallo-peptidase family M12B Reprolysin-like
12	PF13688 Reprolysin_5	7.3e+02	11.7	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308208

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218388	0.999	Metalloproteinase inhibitor 1
2	9606.ENSP00000262768	0.999	Metalloproteinase inhibitor 2
3	9606.ENSP00000483552	0.995	Furin
4	9606.ENSP00000398632	0.989	CD44 antigen
5	9606.ENSP00000391669	0.979	Breast cancer anti-estrogen resistance protein 1
6	9606.ENSP00000349677	0.969	Testican-3
7	9606.ENSP00000363827	0.952	Basement membrane-specific heparan sulfate proteoglycan core protein
8	9606.ENSP00000052754	0.951	Decorin
9	9606.ENSP00000264187	0.951	Nidogen-1
10	9606.ENSP00000339191	0.951	Caveolin-1
11	9606.ENSP00000384136	0.947	Radixin
12	9606.ENSP00000333666	0.942	1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
13	9606.ENSP00000260302	0.931	Collagenase 3
14	9606.ENSP00000264144	0.931	Laminin subunit gamma-2
15	9606.ENSP00000258341	0.929	Laminin subunit gamma-1
16	9606.ENSP00000362680	0.929	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000375778	0.929	Laminin subunit beta-3
18	9606.ENSP00000222399	0.925	Laminin subunit beta-1
19	9606.ENSP00000219070	0.923	72 kDa type IV collagenase
20	9606.ENSP00000309124	0.921	Oxidized low-density lipoprotein receptor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0004222	0.999	metalloendopeptidase activity
GO:0005515	0.994	protein binding
GO:0043167	0.930	ion binding
GO:0046914	0.918	transition metal ion binding
GO:0008270	0.913	zinc ion binding
GO:0004177	0.912	aminopeptidase activity
GO:0070006	0.900	metalloaminopeptidase activity
GO:0004252	0.502	serine-type endopeptidase activity
GO:0005102	0.346	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0032502	0.985	developmental process
GO:0032501	0.984	multicellular organismal process
GO:0048856	0.977	anatomical structure development
GO:0065007	0.975	biological regulation
GO:0050789	0.966	regulation of biological process
GO:0050896	0.965	response to stimulus
GO:0050794	0.957	regulation of cellular process
GO:0048731	0.951	system development
GO:0048870	0.948	cell motility
GO:0006508	0.937	proteolysis
GO:0048513	0.934	animal organ development
GO:0009653	0.906	anatomical structure morphogenesis
GO:0048518	0.850	positive regulation of biological process
GO:0009888	0.848	tissue development
GO:0050793	0.823	regulation of developmental process
GO:0030334	0.815	regulation of cell migration
GO:0048522	0.811	positive regulation of cellular process
GO:0048519	0.798	negative regulation of biological process
GO:0048598	0.795	embryonic morphogenesis
GO:0060348	0.781	bone development
GO:0071840	0.778	cellular component organization or biogenesis
GO:0001503	0.773	ossification
GO:0016043	0.768	cellular component organization
GO:0030198	0.745	extracellular matrix organization
GO:0060350	0.744	endochondral bone morphogenesis
GO:0016477	0.739	cell migration
GO:0042221	0.736	response to chemical
GO:0019222	0.733	regulation of metabolic process
GO:0001958	0.725	endochondral ossification
GO:0032963	0.709	collagen metabolic process
GO:0048869	0.708	cellular developmental process
GO:0048523	0.687	negative regulation of cellular process
GO:0051128	0.679	regulation of cellular component organization
GO:0030154	0.678	cell differentiation
GO:0022617	0.643	extracellular matrix disassembly
GO:0048646	0.629	anatomical structure formation involved in morphogenesis
GO:0060255	0.605	regulation of macromolecule metabolic process
GO:0051239	0.573	regulation of multicellular organismal process
GO:0002009	0.569	morphogenesis of an epithelium
GO:0040017	0.521	positive regulation of locomotion
GO:0007369	0.512	gastrulation
GO:0051171	0.487	regulation of nitrogen compound metabolic process
GO:0048583	0.483	regulation of response to stimulus
GO:0001704	0.482	formation of primary germ layer
GO:0080090	0.476	regulation of primary metabolic process
GO:0051716	0.472	cellular response to stimulus
GO:0035987	0.467	endodermal cell differentiation
GO:0030335	0.456	positive regulation of cell migration
GO:0010604	0.451	positive regulation of macromolecule metabolic process
GO:0010468	0.441	regulation of gene expression
GO:0051173	0.438	positive regulation of nitrogen compound metabolic process
GO:0009056	0.430	catabolic process
GO:0051246	0.424	regulation of protein metabolic process
GO:0023051	0.397	regulation of signaling
GO:0010646	0.368	regulation of cell communication
GO:0009966	0.360	regulation of signal transduction
GO:0006950	0.323	response to stress
GO:0065009	0.304	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0071944	0.986	cell periphery
GO:0043226	0.986	organelle
GO:0043229	0.982	intracellular organelle
GO:0005576	0.975	extracellular region
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0005886	0.965	plasma membrane
GO:0012505	0.961	endomembrane system
GO:0005615	0.807	extracellular space
GO:0070013	0.628	intracellular organelle lumen
GO:0031982	0.617	vesicle
GO:0070062	0.383	extracellular exosome
GO:0031981	0.380	nuclear lumen
GO:0070161	0.339	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	0.999	Metalloendopeptidases.
EC:3.4.11.-	0.912	Aminopeptidases.
EC:3.4.21.-	0.502	Serine endopeptidases.

[back to server]