StarFunc result for job id P50406

User Input

>input (440 residues)
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50406	1.000	1.000	2.061E-53	440	1.000	1.000	P50406.pdb.gz	5HT6R_HUMAN 5-hydroxytryptamine receptor 6 OS=Homo sapiens OX=9606 GN=HTR6 PE=1 SV=1
2	AFDB:Q9R1C8	0.812	0.812	2.723E-46	440	0.882	0.882	Q9R1C8.pdb.gz	5HT6R_MOUSE 5-hydroxytryptamine receptor 6 OS=Mus musculus OX=10090 GN=Htr6 PE=1 SV=1
3	AFDB:P31388	0.751	0.758	3.003E-40	436	0.761	0.768	P31388.pdb.gz	5HT6R_RAT 5-hydroxytryptamine receptor 6 OS=Rattus norvegicus OX=10116 GN=Htr6 PE=1 SV=2
4	PDB:7xtbR	0.598	0.930	5.397E-28	278	0.630	0.996	7xtbR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
5	AFDB:P18901	0.671	0.663	4.104E-20	446	0.300	0.296	P18901.pdb.gz	DRD1_RAT D(1A) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd1 PE=1 SV=2
6	AFDB:P07700	0.664	0.607	1.053E-19	483	0.309	0.282	P07700.pdb.gz	ADRB1_MELGA Beta-1 adrenergic receptor OS=Meleagris gallopavo OX=9103 GN=ADRB1 PE=1 SV=1
7	AFDB:P08588	0.657	0.609	1.249E-19	477	0.316	0.291	P08588.pdb.gz	ADRB1_HUMAN Beta-1 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB1 PE=1 SV=3
8	AFDB:A0A2R8QNL3	0.677	0.726	3.643E-19	409	0.264	0.284	A0A2R8QNL3.pdb.gz
9	AFDB:P13945	0.644	0.692	3.643E-19	408	0.286	0.309	P13945.pdb.gz	ADRB3_HUMAN Beta-3 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB3 PE=1 SV=3
10	AFDB:B3DHM6	0.643	0.723	6.089E-19	390	0.241	0.272	B3DHM6.pdb.gz	B3DHM6_DANRE Adrenergic, beta-1-, receptor OS=Danio rerio OX=7955 GN=zgc:194728 PE=2 SV=1
11	AFDB:H0YPZ4	0.643	0.626	6.089E-19	453	0.273	0.265	H0YPZ4.pdb.gz	H0YPZ4_TAEGU Dopamine receptor D1 OS=Taeniopygia guttata OX=59729 GN=DRD1 PE=3 SV=1
12	PDB:6iblA	0.568	0.626	2.672E-16	397	0.248	0.275	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
13	PDB:7jvqR	0.579	0.873	3.763E-16	286	0.257	0.395	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
14	PDB:7e32R	0.551	0.836	2.965E-14	285	0.218	0.337	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
15	PDB:7xtcR	0.558	0.878	2.965E-14	275	0.225	0.360	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
16	PDB:7xt8R	0.564	0.829	5.635E-14	294	0.227	0.340	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
17	PDB:7e2xR	0.563	0.872	8.283E-14	278	0.218	0.345	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
18	PDB:4ldeA	0.557	0.540	9.418E-14	454	0.205	0.198	4ldeA.pdb.gz	Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
19	PDB:7f61A	0.583	0.832	1.950E-13	301	0.205	0.299	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
20	PDB:7jvrR	0.554	0.884	2.992E-13	269	0.227	0.372	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P31388	0.0	595	436	0.730	0.736	5HT6R_RAT 5-hydroxytryptamine receptor 6 OS=Rattus norvegicus OX=10116 GN=Htr6 PE=1 SV=2
2	P50406	0.0	869	440	1.000	1.000	5HT6R_HUMAN 5-hydroxytryptamine receptor 6 OS=Homo sapiens OX=9606 GN=HTR6 PE=1 SV=1
3	Q9R1C8	0.0	718	440	0.882	0.882	5HT6R_MOUSE 5-hydroxytryptamine receptor 6 OS=Mus musculus OX=10090 GN=Htr6 PE=1 SV=1
4	P21728	4.09e-60	204	446	0.289	0.285	DRD1_HUMAN D(1A) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD1 PE=1 SV=1
5	P41596	1.33e-59	204	511	0.275	0.237	DOPR1_DROME Dopamine receptor 1 OS=Drosophila melanogaster OX=7227 GN=Dop1R1 PE=2 SV=2
6	P18901	7.89e-58	198	446	0.293	0.289	DRD1_RAT D(1A) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd1 PE=1 SV=2
7	Q61616	1.74e-57	197	446	0.286	0.283	DRD1_MOUSE D(1A) dopamine receptor OS=Mus musculus OX=10090 GN=Drd1 PE=1 SV=2
8	Q7LZ75	1.17e-53	187	450	0.252	0.247	Q7LZ75_CHICK Dopamine receptor D1A OS=Gallus gallus OX=9031 PE=3 SV=1
9	P07700	1.37e-53	188	483	0.307	0.280	ADRB1_MELGA Beta-1 adrenergic receptor OS=Meleagris gallopavo OX=9103 GN=ADRB1 PE=1 SV=1
10	B8YLW8	1.39e-53	187	451	0.252	0.246	B8YLW8_CHICK Dopamine D1A receptor OS=Gallus gallus OX=9031 GN=D1A PE=2 SV=1
11	H0YPZ4	2.02e-53	187	453	0.257	0.249	H0YPZ4_TAEGU Dopamine receptor D1 OS=Taeniopygia guttata OX=59729 GN=DRD1 PE=3 SV=1
12	P34971	5.32e-53	186	466	0.270	0.255	ADRB1_MOUSE Beta-1 adrenergic receptor OS=Mus musculus OX=10090 GN=Adrb1 PE=1 SV=2
13	G1NR41	7.00e-53	185	451	0.250	0.244	G1NR41_MELGA Dopamine receptor D1 OS=Meleagris gallopavo OX=9103 GN=DRD1 PE=3 SV=1
14	P18090	2.10e-52	184	466	0.270	0.255	ADRB1_RAT Beta-1 adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adrb1 PE=1 SV=1
15	Q8BLD9	3.05e-52	184	478	0.280	0.257	DRD5_MOUSE D(1B) dopamine receptor OS=Mus musculus OX=10090 GN=Drd5 PE=2 SV=1
16	Q9VCZ3	5.87e-52	184	508	0.257	0.222	OCTB1_DROME Octopamine receptor beta-1R OS=Drosophila melanogaster OX=7227 GN=Octbeta1R PE=2 SV=1
17	Q4LBB9	1.65e-51	183	536	0.255	0.209	OCTB2_DROME Octopamine receptor beta-2R OS=Drosophila melanogaster OX=7227 GN=Octbeta2R PE=2 SV=2
18	G3M4F8	1.70e-51	180	395	0.264	0.294	OCTB2_CHISP Octopamine receptor beta-2R OS=Chilo suppressalis OX=168631 GN=OA2B2 PE=2 SV=1
19	P25115	3.37e-51	181	475	0.268	0.248	DRD5_RAT D(1B) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd5 PE=2 SV=1
20	B3DHM6	4.34e-51	179	390	0.264	0.297	B3DHM6_DANRE Adrenergic, beta-1-, receptor OS=Danio rerio OX=7955 GN=zgc:194728 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	6e-62	220.9	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	1.1e+02	14.0	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	37	15.2	Serpentine type 7TM GPCR chemoreceptor Srsx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000289753

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419782	0.899	Cyclin-dependent-like kinase 5
2	9606.ENSP00000360141	0.879	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
3	9606.ENSP00000337949	0.840	5-hydroxytryptamine receptor 7
4	9606.ENSP00000350512	0.811	COP9 signalosome complex subunit 5
5	9606.ENSP00000346671	0.806	Tyrosine-protein kinase Fyn
6	9606.ENSP00000347754	0.721	5-hydroxytryptamine receptor 3A
7	9606.ENSP00000334051	0.686	Guanine nucleotide-binding protein G(olf) subunit alpha
8	9606.ENSP00000351015	0.670	Neurofibromin
9	9606.ENSP00000384092	0.655	Pro-opiomelanocortin
10	9606.ENSP00000356213	0.634	VIP peptides
11	9606.ENSP00000387662	0.616	Glucagon
12	9606.ENSP00000256592	0.610	Thyrotropin subunit beta
13	9606.ENSP00000462647	0.609	Pituitary adenylate cyclase-activating polypeptide
14	9606.ENSP00000350005	0.600	Gastric inhibitory polypeptide
15	9606.ENSP00000365663	0.600	Natriuretic peptides A
16	9606.ENSP00000416606	0.600	Follitropin subunit beta
17	9606.ENSP00000370950	0.587	Neuropeptide S receptor
18	9606.ENSP00000296755	0.539	Microtubule-associated protein 1B
19	9606.ENSP00000289429	0.504	T-cell surface glycoprotein CD1a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008227	1.000	G protein-coupled amine receptor activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.988	response to stimulus
GO:0007165	0.975	signal transduction
GO:0007186	0.948	G protein-coupled receptor signaling pathway
GO:0010646	0.914	regulation of cell communication
GO:0023051	0.906	regulation of signaling
GO:0048518	0.835	positive regulation of biological process
GO:0032501	0.810	multicellular organismal process
GO:0048583	0.791	regulation of response to stimulus
GO:0048522	0.736	positive regulation of cellular process
GO:1902531	0.665	regulation of intracellular signal transduction
GO:0007187	0.576	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0032008	0.528	positive regulation of TOR signaling
GO:0032502	0.439	developmental process
GO:0048856	0.427	anatomical structure development
GO:0007275	0.310	multicellular organism development
GO:0065008	0.307	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.972	membrane-bounded organelle
GO:0042995	0.839	cell projection
GO:0005622	0.785	intracellular anatomical structure
GO:0120025	0.767	plasma membrane bounded cell projection
GO:0005737	0.737	cytoplasm
GO:0012505	0.439	endomembrane system
GO:0005929	0.403	cilium
GO:0036477	0.338	somatodendritic compartment
GO:0043229	0.301	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]