StarFunc result for job id P50416

User Input

>input (773 residues)
MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIV
TMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGST
IPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREME
QQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL
DETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPI
VAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLL
ANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCL
YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
GVSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFGLSSNSKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R5F4	0.995	0.995	0.000	773	1.000	1.000	A0A024R5F4.pdb.gz
2	AFDB:A0A1L1U0X8	0.976	0.974	0.000	774	0.702	0.702	A0A1L1U0X8.pdb.gz
3	AFDB:E9QI17	0.987	0.984	0.000	775	0.715	0.714	E9QI17.pdb.gz	E9QI17_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=2
4	AFDB:F6P7Z9	0.978	0.982	0.000	770	0.668	0.670	F6P7Z9.pdb.gz	F6P7Z9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1al PE=3 SV=2
5	AFDB:P32198	0.998	0.998	0.000	773	0.865	0.865	P32198.pdb.gz	CPT1A_RAT Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus OX=10116 GN=Cpt1a PE=1 SV=2
6	AFDB:Q2UZM8	0.983	0.983	0.000	773	0.708	0.708	Q2UZM8.pdb.gz	Q2UZM8_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=cpt1 PE=2 SV=1
7	AFDB:Q63704	0.981	0.982	0.000	772	0.626	0.627	Q63704.pdb.gz	CPT1B_RAT Carnitine O-palmitoyltransferase 1, muscle isoform OS=Rattus norvegicus OX=10116 GN=Cpt1b PE=1 SV=1
8	AFDB:Q8AYL4	0.921	0.949	0.000	750	0.648	0.668	Q8AYL4.pdb.gz	Q8AYL4_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=CPT1 PE=2 SV=2
9	AFDB:Q92523	0.985	0.986	0.000	772	0.627	0.628	Q92523.pdb.gz	CPT1B_HUMAN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=2
10	AFDB:Q8TCG5	0.957	0.922	1.283E-100	803	0.546	0.526	Q8TCG5.pdb.gz	CPT1C_HUMAN Carnitine O-palmitoyltransferase 1, brain isoform OS=Homo sapiens OX=9606 GN=CPT1C PE=1 SV=1
11	PDB:2h3pA	0.699	0.896	8.899E-51	599	0.232	0.299	2h3pA.pdb.gz	Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates
12	PDB:1q6xA	0.700	0.894	5.819E-48	600	0.241	0.310	1q6xA.pdb.gz
13	PDB:1xl8B	0.713	0.913	2.044E-47	600	0.230	0.297	1xl8B.pdb.gz	Crystal structure of mouse carnitine octanoyltransferase and molecular determinants of substrate selectivity.
14	PDB:4eywB	0.703	0.853	1.283E-43	634	0.211	0.257	4eywB.pdb.gz	Isothermal titration calorimetry with micelles: Thermodynamics of inhibitor binding to carnitine palmitoyltransferase 2 membrane protein.
15	PDB:6lpwB	0.194	0.308	1.643E-5	436	0.043	0.076	6lpwB.pdb.gz	Structural and Biochemical Insights Into Two BAHD Acyltransferases ( At SHT and At SDT) Involved in Phenolamide Biosynthesis.
16	PDB:1l5aA	0.254	0.406	1.109E-4	424	0.066	0.120	1l5aA.pdb.gz
17	PDB:2xr7A	0.200	0.304	1.426E-4	452	0.050	0.086	2xr7A.pdb.gz	Structural Basis for Modification of Flavonol and Naphthol Glucoconjugates by Nicotiana Tabacum Malonyltransferase (Ntmat1).
18	PDB:6wcsA	0.221	0.351	3.350E-4	438	0.057	0.100	6wcsA.pdb.gz
19	PDB:6waoB	0.203	0.347	4.530E-4	406	0.053	0.101	6waoB.pdb.gz	The structural basis of the isochorismoyl-glutamate pyruvoyl-glutamate lyase activity of Arabidopsis EPS1 in salicylic acid biosynthesis
20	PDB:6mk2A	0.186	0.307	1.119E-3	407	0.052	0.098	6mk2A.pdb.gz	Independent evolution of rosmarinic acid biosynthesis in two sister families under the Lamiids clade of flowering plants.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRE8	0.0	805	567	0.480	0.654	A2RRE8_HUMAN CPT1B protein OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=1
2	E9QI17	0.0	1204	775	0.717	0.715	E9QI17_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=2
3	F1LN46	0.0	861	801	0.525	0.507	CPT1C_RAT Carnitine O-palmitoyltransferase 1, brain isoform OS=Rattus norvegicus OX=10116 GN=Cpt1c PE=1 SV=1
4	F6P7Z9	0.0	1118	770	0.670	0.673	F6P7Z9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1al PE=3 SV=2
5	K7DY29	0.0	1199	774	0.714	0.713	K7DY29_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1ab PE=1 SV=1
6	P32198	0.0	1437	773	0.865	0.865	CPT1A_RAT Carnitine O-palmitoyltransferase 1, liver isoform OS=Rattus norvegicus OX=10116 GN=Cpt1a PE=1 SV=2
7	P50416	0.0	1624	773	1.000	1.000	CPT1A_HUMAN Carnitine O-palmitoyltransferase 1, liver isoform OS=Homo sapiens OX=9606 GN=CPT1A PE=1 SV=2
8	P97742	0.0	1451	773	0.865	0.865	CPT1A_MOUSE Carnitine O-palmitoyltransferase 1, liver isoform OS=Mus musculus OX=10090 GN=Cpt1a PE=1 SV=4
9	Q1MTA9	0.0	1159	773	0.704	0.704	Q1MTA9_DANRE carnitine O-palmitoyltransferase OS=Danio rerio OX=7955 GN=cpt1a PE=1 SV=2
10	Q2UZM8	0.0	1157	773	0.713	0.713	Q2UZM8_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=cpt1 PE=2 SV=1
11	Q63704	0.0	1046	772	0.627	0.628	CPT1B_RAT Carnitine O-palmitoyltransferase 1, muscle isoform OS=Rattus norvegicus OX=10116 GN=Cpt1b PE=1 SV=1
12	Q7JQH9	0.0	795	780	0.511	0.506	Q7JQH9_DROME carnitine O-palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=whd PE=1 SV=1
13	Q8AYL4	0.0	1084	750	0.651	0.671	Q8AYL4_ONCMY carnitine O-palmitoyltransferase OS=Oncorhynchus mykiss OX=8022 GN=CPT1 PE=2 SV=2
14	Q8BGD5	0.0	865	798	0.530	0.514	CPT1C_MOUSE Carnitine O-palmitoyltransferase 1, brain isoform OS=Mus musculus OX=10090 GN=Cpt1c PE=1 SV=1
15	Q8TCG5	0.0	919	803	0.547	0.527	CPT1C_HUMAN Carnitine O-palmitoyltransferase 1, brain isoform OS=Homo sapiens OX=9606 GN=CPT1C PE=1 SV=1
16	Q924X2	0.0	1051	772	0.631	0.632	CPT1B_MOUSE Carnitine O-palmitoyltransferase 1, muscle isoform OS=Mus musculus OX=10090 GN=Cpt1b PE=1 SV=1
17	Q92523	0.0	1057	772	0.629	0.630	CPT1B_HUMAN Carnitine O-palmitoyltransferase 1, muscle isoform OS=Homo sapiens OX=9606 GN=CPT1B PE=1 SV=2
18	Q9V3K9	0.0	792	782	0.507	0.501	Q9V3K9_DROME carnitine O-palmitoyltransferase OS=Drosophila melanogaster OX=7227 GN=whd PE=1 SV=1
19	Q704S8	2.78e-89	295	626	0.252	0.312	CACP_RAT Carnitine O-acetyltransferase OS=Rattus norvegicus OX=10116 GN=Crat PE=1 SV=1
20	P43155	3.02e-88	293	626	0.257	0.318	CACP_HUMAN Carnitine O-acetyltransferase OS=Homo sapiens OX=9606 GN=CRAT PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00755 Carn_acyltransf	4.6e-193	654.5	Choline/Carnitine o-acyltransferase
2	PF16484 CPT_N	3.4e-24	95.8	Carnitine O-palmitoyltransferase N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265641

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293217	0.984	Peroxisomal acyl-coenzyme A oxidase 1
2	9606.ENSP00000385523	0.983	Peroxisome proliferator-activated receptor alpha
3	9606.ENSP00000326305	0.982	Mitochondrial carnitine/acylcarnitine carrier protein
4	9606.ENSP00000264867	0.972	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
5	9606.ENSP00000231887	0.965	Peroxisomal bifunctional enzyme
6	9606.ENSP00000295834	0.961	Fatty acid-binding protein, liver
7	9606.ENSP00000309757	0.956	Lipoprotein lipase
8	9606.ENSP00000477707	0.950	Oxysterols receptor LXR-alpha
9	9606.ENSP00000341044	0.948	Acetyl-CoA carboxylase 2
10	9606.ENSP00000236850	0.943	Apolipoprotein A-I
11	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
12	9606.ENSP00000360541	0.937	Carnitine O-palmitoyltransferase 2, mitochondrial
13	9606.ENSP00000419692	0.933	Retinoic acid receptor RXR-alpha
14	9606.ENSP00000358719	0.922	Malic enzyme 1
15	9606.ENSP00000383063	0.921	Nuclear receptor-interacting protein 1
16	9606.ENSP00000360266	0.917	Transcription factor AP-1
17	9606.ENSP00000420914	0.914	Peroxisomal multifunctional enzyme type 2
18	9606.ENSP00000263253	0.912	Histone acetyltransferase p300
19	9606.ENSP00000356969	0.911	Apolipoprotein A-II
20	9606.ENSP00000385216	0.907	Nuclear receptor coactivator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004095	1.000	carnitine O-palmitoyltransferase activity
GO:0005515	0.993	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.965	organic substance metabolic process
GO:0044238	0.962	primary metabolic process
GO:0044237	0.961	cellular metabolic process
GO:0006869	0.903	lipid transport
GO:0065007	0.873	biological regulation
GO:0006631	0.847	fatty acid metabolic process
GO:0015718	0.817	monocarboxylic acid transport
GO:0016042	0.810	lipid catabolic process
GO:0015909	0.810	long-chain fatty acid transport
GO:0050789	0.789	regulation of biological process
GO:0050794	0.761	regulation of cellular process
GO:0044242	0.751	cellular lipid catabolic process
GO:0006635	0.736	fatty acid beta-oxidation
GO:0006807	0.557	nitrogen compound metabolic process
GO:0019222	0.478	regulation of metabolic process
GO:0050896	0.466	response to stimulus
GO:0080090	0.439	regulation of primary metabolic process
GO:0031323	0.430	regulation of cellular metabolic process
GO:1901564	0.415	organonitrogen compound metabolic process
GO:0032501	0.349	multicellular organismal process
GO:0032502	0.332	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.997	membrane
GO:0005739	0.997	mitochondrion
GO:0031090	0.987	organelle membrane
GO:0031967	0.858	organelle envelope
GO:0098588	0.834	bounding membrane of organelle
GO:0031966	0.834	mitochondrial membrane
GO:0005741	0.679	mitochondrial outer membrane
GO:0070013	0.333	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12661	1.000	(R)-carnitine + hexadecanoyl-CoA = CoA + O-hexadecanoyl-(R)-carnitine
EC:2.3.1.21	1.000	carnitine O-palmitoyltransferase.

[back to server]