StarFunc result for job id P50440

User Input

>input (423 residues)
MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPL
PKDCPVSSYNEWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHL
KKAVAEIEEMCNILKTEGVTVRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEII
EAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYNQDYPIHSVEDRHKLAA
QGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN
PMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHPLWMSSKWLSM
NVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQS
YLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VK19	0.877	0.877	1.281E-88	423	1.000	1.000	A0A140VK19.pdb.gz	A0A140VK19_HUMAN Glycine amidinotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:1jdxA	0.844	0.991	1.146E-75	360	0.851	1.000	1jdxA.pdb.gz	The ligand-induced structural changes of human L-Arginine:Glycine amidinotransferase. A mutational and crystallographic study.
3	AFDB:P9WQ05	0.498	0.522	3.866E-12	402	0.132	0.139	P9WQ05.pdb.gz	ARCA_MYCTU Arginine deiminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=arcA PE=1 SV=1
4	AFDB:P13981	0.542	0.548	4.361E-12	418	0.111	0.112	P13981.pdb.gz	ARCA_PSEAE Arginine deiminase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arcA PE=1 SV=2
5	AFDB:F4ZCI3	0.496	0.548	6.562E-11	379	0.116	0.129	F4ZCI3.pdb.gz	NNHA_MYCS0 2-nitroimidazole nitrohydrolase OS=Mycobacterium sp. (strain JS330) OX=1004011 GN=nnhA PE=1 SV=1
6	PDB:1rxxC	0.542	0.555	1.721E-10	412	0.118	0.121	1rxxC.pdb.gz
7	PDB:6szqD	0.492	0.702	4.512E-10	286	0.111	0.164	6szqD.pdb.gz
8	PDB:5hp5A	0.428	0.285	3.572E-6	669	0.109	0.069	5hp5A.pdb.gz	Monomeric Form of Peptidylarginine Deiminase Type I Revealed by X-ray Crystallography and Small-Angle X-ray Scattering
9	PDB:3h7cX	0.396	0.444	4.828E-6	369	0.109	0.125	3h7cX.pdb.gz	Structural Insights into the Catalytic Mechanism of Arabidopsis thaliana Agmatine Deiminase
10	PDB:5n0zA	0.441	0.307	1.817E-5	638	0.111	0.074	5n0zA.pdb.gz	Development of a Selective Inhibitor of Protein Arginine Deiminase 2.
11	PDB:1ynhB	0.493	0.476	3.125E-5	440	0.121	0.116	1ynhB.pdb.gz	Crystal structure of N-succinylarginine dihydrolase AstB, bound to substrate and product, an enzyme from the arginine catabolic pathway of Escherichia coli.
12	PDB:7bt6y	0.289	0.462	2.734E-4	244	0.057	0.098	7bt6y.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	PDB:7d56C	0.321	0.224	4.702E-4	640	0.123	0.081	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
14	PDB:4n2iA	0.428	0.288	1.477E-3	662	0.099	0.063	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
15	AFDB:Q9ZUU2	0.080	0.122	4.006E-1	248	0.057	0.097	Q9ZUU2.pdb.gz	PXL2C_ARATH Thioredoxin-like protein AAED1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At2g37240 PE=1 SV=2
16	AFDB:Q8C2S0	0.092	0.062	6.486E-1	711	0.061	0.037	Q8C2S0.pdb.gz	UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus OX=10090 GN=Usp44 PE=1 SV=3
17	AFDB:C0H5Y5	0.057	0.052	9.889E-1	480	0.028	0.025	C0H5Y5.pdb.gz	C0H5Y5_RAT CASP8 and FADD-like apoptosis regulator OS=Rattus norvegicus OX=10116 GN=Cflar PE=3 SV=1
18	AFDB:A0JQ78	0.097	0.158	1.116	212	0.061	0.123	A0JQ78.pdb.gz	A0JQ78_ARATH At3g10405 OS=Arabidopsis thaliana OX=3702 GN=At3g10405 PE=1 SV=1
19	AFDB:Q7ZUM8	0.080	0.053	1.701	695	0.050	0.030	Q7ZUM8.pdb.gz	UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio OX=7955 GN=usp44 PE=2 SV=1
20	AFDB:F4KJ62	0.101	0.135	2.441	271	0.071	0.111	F4KJ62.pdb.gz	F4KJ62_ARATH dTMP kinase OS=Arabidopsis thaliana OX=3702 GN=ZEU1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VK19	0.0	889	423	1.000	1.000	A0A140VK19_HUMAN Glycine amidinotransferase OS=Homo sapiens OX=9606 PE=2 SV=1
2	P50440	0.0	889	423	1.000	1.000	GATM_HUMAN Glycine amidinotransferase, mitochondrial OS=Homo sapiens OX=9606 GN=GATM PE=1 SV=1
3	P50442	0.0	860	423	0.955	0.955	GATM_RAT Glycine amidinotransferase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Gatm PE=1 SV=1
4	Q9D964	0.0	862	423	0.957	0.957	GATM_MOUSE Glycine amidinotransferase, mitochondrial OS=Mus musculus OX=10090 GN=Gatm PE=1 SV=1
5	Q6J4H1	1.8	33.5	1929	0.066	0.015	Q6J4H1_CHLRE Central pair complex 1 OS=Chlamydomonas reinhardtii OX=3055 GN=CPC1 PE=1 SV=1
6	Q8H0Y1	2.1	32.3	213	0.047	0.094	OP24B_ARATH Outer envelope pore protein 24B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP24B PE=2 SV=1
7	Q68CR1	3.1	32.7	1132	0.043	0.016	SE1L3_HUMAN Protein sel-1 homolog 3 OS=Homo sapiens OX=9606 GN=SEL1L3 PE=1 SV=2
8	G5EDF8	7.8	30.8	277	0.057	0.087	G5EDF8_CAEEL F-box domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fbxa-151 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02274 ADI	21	15.6	Arginine deiminase
2	PF19420 DDAH_eukar	58	14.3	N,N dimethylarginine dimethylhydrolase, eukaryotic

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000403536	0.991	Guanidinoacetate N-methyltransferase
2	9606.ENSP00000294517	0.959	Antizyme inhibitor 2
3	9606.ENSP00000261783	0.950	Arginase-2, mitochondrial
4	9606.ENSP00000228476	0.947	D-amino-acid oxidase
5	9606.ENSP00000349446	0.944	Arginase-1
6	9606.ENSP00000231420	0.941	Alanine--glyoxylate aminotransferase 2, mitochondrial
7	9606.ENSP00000361894	0.937	Glycine N-methyltransferase
8	9606.ENSP00000302620	0.931	Alanine-glyoxylate aminotransferase
9	9606.ENSP00000318868	0.930	Serine hydroxymethyltransferase, cytosolic
10	9606.ENSP00000360938	0.927	Sarcosine dehydrogenase, mitochondrial
11	9606.ENSP00000333667	0.925	Serine hydroxymethyltransferase, mitochondrial
12	9606.ENSP00000370737	0.925	Glycine dehydrogenase (decarboxylating), mitochondrial
13	9606.ENSP00000297494	0.922	Nitric oxide synthase, endothelial
14	9606.ENSP00000477999	0.922	Nitric oxide synthase, brain
15	9606.ENSP00000261733	0.916	Aldehyde dehydrogenase, mitochondrial
16	9606.ENSP00000327251	0.915	Nitric oxide synthase, inducible
17	9606.ENSP00000378416	0.914	5-aminolevulinate synthase, nonspecific, mitochondrial
18	9606.ENSP00000351682	0.912	Carnosine dipeptidase 1
19	9606.ENSP00000366927	0.912	Aldehyde dehydrogenase X, mitochondrial
20	9606.ENSP00000345774	0.911	Fatty aldehyde dehydrogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015067	1.000	amidinotransferase activity
GO:0005515	0.999	protein binding
GO:0015068	0.950	glycine amidinotransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0044249	0.977	cellular biosynthetic process
GO:1901564	0.971	organonitrogen compound metabolic process
GO:0006575	0.932	cellular modified amino acid metabolic process
GO:0044281	0.914	small molecule metabolic process
GO:0043436	0.895	oxoacid metabolic process
GO:0019752	0.893	carboxylic acid metabolic process
GO:0032501	0.890	multicellular organismal process
GO:1901576	0.866	organic substance biosynthetic process
GO:0050896	0.864	response to stimulus
GO:1901566	0.863	organonitrogen compound biosynthetic process
GO:0044283	0.777	small molecule biosynthetic process
GO:0065007	0.658	biological regulation
GO:0032787	0.562	monocarboxylic acid metabolic process
GO:0042398	0.556	cellular modified amino acid biosynthetic process
GO:0050789	0.479	regulation of biological process
GO:0046394	0.467	carboxylic acid biosynthetic process
GO:0044238	0.413	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.704	intracellular organelle lumen
GO:0005576	0.311	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.4.-	1.000	Amidinotransferases.
RHEA:13201	0.950	glycine + L-arginine = guanidinoacetate + L-ornithine
EC:2.1.4.1	0.950	glycine amidinotransferase.

[back to server]