StarFunc result for job id P50452

User Input

>input (374 residues)
MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCL
YKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELS
FAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYT
RGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAV
VEKALTYEKFKAWTNSEKLTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFS
GMSTEKNVPLSKVAHKCFVEVNEEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFIRHH
KTNCILFCGRFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50452	1.000	1.000	4.830E-85	374	1.000	1.000	P50452.pdb.gz	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
2	AFDB:Q60854	0.952	0.942	1.334E-64	378	0.660	0.653	Q60854.pdb.gz	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
3	AFDB:P35237	0.974	0.969	1.599E-64	376	0.674	0.670	P35237.pdb.gz	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
4	AFDB:O08804	0.952	0.945	1.309E-62	377	0.615	0.610	O08804.pdb.gz	O08804_MOUSE NK13 OS=Mus musculus OX=10090 GN=Serpinb6b PE=1 SV=2
5	AFDB:A0A024QZT4	0.952	0.947	8.939E-61	376	0.623	0.620	A0A024QZT4.pdb.gz	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:O08797	0.971	0.971	2.470E-59	374	0.556	0.556	O08797.pdb.gz	O08797_MOUSE SPI6 OS=Mus musculus OX=10090 GN=Serpinb9 PE=1 SV=1
7	AFDB:Q80UK5	0.956	0.948	1.510E-58	377	0.527	0.523	Q80UK5.pdb.gz	Q80UK5_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9f OS=Mus musculus OX=10090 GN=Serpinb9f PE=2 SV=1
8	AFDB:P30740	0.973	0.961	9.708E-57	379	0.524	0.517	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
9	AFDB:Q9D154	0.971	0.958	1.775E-56	379	0.519	0.512	Q9D154.pdb.gz	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
10	AFDB:Q3TJ69	0.949	0.941	8.522E-56	377	0.513	0.509	Q3TJ69.pdb.gz	Q3TJ69_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
11	PDB:4ga7A	0.945	0.958	6.191E-54	369	0.508	0.515	4ga7A.pdb.gz
12	PDB:2zv6B	0.947	0.954	1.135E-47	371	0.455	0.458	2zv6B.pdb.gz
13	PDB:2h4rA	0.926	0.934	2.342E-47	371	0.422	0.426	2h4rA.pdb.gz
14	PDB:2arqA	0.895	0.929	2.320E-46	360	0.455	0.472	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
15	PDB:1xqgA	0.926	0.916	5.083E-46	378	0.380	0.376	1xqgA.pdb.gz
16	PDB:2ol2A	0.886	0.919	2.651E-41	360	0.329	0.342	2ol2A.pdb.gz
17	PDB:1hp7A	0.910	0.906	5.148E-41	376	0.321	0.319	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
18	PDB:1yxaA	0.884	0.888	3.550E-40	372	0.340	0.341	1yxaA.pdb.gz
19	PDB:4dteA	0.888	0.888	7.323E-40	374	0.316	0.316	4dteA.pdb.gz
20	PDB:1jmoA	0.893	0.787	1.339E-39	427	0.307	0.269	1jmoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50452	0.0	778	374	1.000	1.000	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
2	P35237	3.57e-175	494	376	0.676	0.673	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
3	A0A024QZT4	4.98e-172	486	376	0.631	0.628	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
4	P50453	4.98e-172	486	376	0.631	0.628	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
5	Q60854	9.41e-168	475	378	0.663	0.656	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
6	O08804	1.76e-154	441	377	0.618	0.613	O08804_MOUSE NK13 OS=Mus musculus OX=10090 GN=Serpinb6b PE=1 SV=2
7	O08797	1.02e-147	424	374	0.559	0.559	O08797_MOUSE SPI6 OS=Mus musculus OX=10090 GN=Serpinb9 PE=1 SV=1
8	Q80UK5	7.56e-142	409	377	0.535	0.531	Q80UK5_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9f OS=Mus musculus OX=10090 GN=Serpinb9f PE=2 SV=1
9	Q6P217	1.03e-124	366	377	0.524	0.520	Q6P217_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9b OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
10	Q9DAV6	1.24e-124	365	377	0.524	0.520	Q9DAV6_MOUSE R86 OS=Mus musculus OX=10090 GN=Serpinb9b PE=1 SV=1
11	Q3TJ69	2.13e-123	362	377	0.521	0.517	Q3TJ69_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
12	P30740	5.85e-122	359	379	0.527	0.520	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
13	V9HWH1	5.85e-122	359	379	0.527	0.520	V9HWH1_HUMAN Epididymis luminal protein 57 OS=Homo sapiens OX=9606 GN=HEL57 PE=2 SV=1
14	Q9D154	1.44e-120	355	379	0.516	0.509	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
15	P05120	8.63e-118	349	415	0.484	0.436	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
16	Q8VHP7	7.05e-115	341	382	0.516	0.505	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
17	Q5SV42	1.98e-110	329	375	0.489	0.488	ILEUC_MOUSE Leukocyte elastase inhibitor C OS=Mus musculus OX=10090 GN=Serpinb1c PE=1 SV=1
18	Q8BHL1	2.20e-110	330	387	0.455	0.439	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
19	P48595	3.65e-110	329	397	0.465	0.438	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
20	Q6UKZ2	1.72e-109	327	387	0.452	0.437	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05000 RNA_pol_Rpb1_4	4e+02	12.3	RNA polymerase Rpb1, domain 4
2	PF00079 Serpin	3.6e-127	436.3	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381072

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361850	0.919	Urokinase-type plasminogen activator
2	9606.ENSP00000401645	0.917	Plasminogen activator inhibitor 2
3	9606.ENSP00000339328	0.912	Urokinase plasminogen activator surface receptor
4	9606.ENSP00000311032	0.732	Caspase-3
5	9606.ENSP00000398698	0.667	Tumor necrosis factor
6	9606.ENSP00000304915	0.654	Interleukin-13
7	9606.ENSP00000356263	0.647	Protein-glutamate O-methyltransferase
8	9606.ENSP00000229135	0.643	Interferon gamma
9	9606.ENSP00000011653	0.642	T-cell surface glycoprotein CD4
10	9606.ENSP00000231449	0.642	Interleukin-4
11	9606.ENSP00000231454	0.642	Interleukin-5
12	9606.ENSP00000412237	0.635	Interleukin-10
13	9606.ENSP00000454623	0.633	Integrin alpha-X
14	9606.ENSP00000365380	0.615	Forkhead box protein P3
15	9606.ENSP00000226730	0.611	Interleukin-2
16	9606.ENSP00000295897	0.591	Serum albumin
17	9606.ENSP00000350295	0.572	Zinc finger protein 816
18	9606.ENSP00000385675	0.572	Interleukin-6
19	9606.ENSP00000332049	0.566	T-lymphocyte activation antigen CD86
20	9606.ENSP00000363089	0.559	Toll-like receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004867	1.000	serine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051248	0.995	negative regulation of protein metabolic process
GO:0010951	0.986	negative regulation of endopeptidase activity
GO:0009987	0.976	cellular process
GO:0050896	0.930	response to stimulus
GO:0050794	0.897	regulation of cellular process
GO:0048583	0.562	regulation of response to stimulus
GO:0051716	0.518	cellular response to stimulus
GO:0032501	0.512	multicellular organismal process
GO:0048518	0.446	positive regulation of biological process
GO:0002376	0.416	immune system process
GO:0048523	0.401	negative regulation of cellular process
GO:0006950	0.372	response to stress
GO:0080134	0.369	regulation of response to stress
GO:0042221	0.362	response to chemical
GO:0032101	0.344	regulation of response to external stimulus
GO:0002682	0.339	regulation of immune system process
GO:0051239	0.308	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005737	1.000	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0071944	0.995	cell periphery
GO:0012505	0.995	endomembrane system
GO:0043229	0.995	intracellular organelle
GO:0005829	0.977	cytosol
GO:0005615	0.971	extracellular space
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0016020	0.909	membrane
GO:0031982	0.895	vesicle
GO:1903561	0.874	extracellular vesicle
GO:0031974	0.853	membrane-enclosed lumen
GO:0005886	0.837	plasma membrane
GO:0043233	0.836	organelle lumen
GO:0070013	0.821	intracellular organelle lumen
GO:0005634	0.800	nucleus
GO:0062023	0.667	collagen-containing extracellular matrix
GO:0070062	0.608	extracellular exosome
GO:0097708	0.567	intracellular vesicle
GO:0031410	0.563	cytoplasmic vesicle
GO:0098588	0.542	bounding membrane of organelle
GO:0005794	0.334	Golgi apparatus
GO:0031981	0.320	nuclear lumen
GO:0032991	0.317	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]