StarFunc result for job id P50453

User Input

>input (376 residues)
METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSL
NTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELS
FIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYT
REMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELS
TVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL
SAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIR
HNRANSILFCGRFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZT4	0.971	0.971	1.729E-80	376	1.000	1.000	A0A024QZT4.pdb.gz	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:O08797	0.979	0.984	1.819E-69	374	0.686	0.690	O08797.pdb.gz	O08797_MOUSE SPI6 OS=Mus musculus OX=10090 GN=Serpinb9 PE=1 SV=1
3	AFDB:Q80UK5	0.963	0.960	5.845E-66	377	0.633	0.631	Q80UK5.pdb.gz	Q80UK5_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9f OS=Mus musculus OX=10090 GN=Serpinb9f PE=2 SV=1
4	AFDB:Q3TJ69	0.955	0.952	2.101E-64	377	0.662	0.660	Q3TJ69.pdb.gz	Q3TJ69_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
5	AFDB:P35237	0.972	0.972	1.019E-63	376	0.630	0.630	P35237.pdb.gz	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
6	AFDB:P50452	0.978	0.983	3.646E-63	374	0.620	0.623	P50452.pdb.gz	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
7	AFDB:Q60854	0.956	0.951	6.721E-62	378	0.617	0.614	Q60854.pdb.gz	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
8	AFDB:O08804	0.948	0.946	4.154E-61	377	0.572	0.570	O08804.pdb.gz	O08804_MOUSE NK13 OS=Mus musculus OX=10090 GN=Serpinb6b PE=1 SV=2
9	AFDB:P30740	0.967	0.960	7.308E-57	379	0.513	0.509	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
10	AFDB:Q9D154	0.958	0.951	1.609E-56	379	0.492	0.488	Q9D154.pdb.gz	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
11	PDB:4ga7A	0.937	0.954	5.818E-55	369	0.500	0.509	4ga7A.pdb.gz
12	PDB:2h4rA	0.920	0.933	3.697E-48	371	0.423	0.429	2h4rA.pdb.gz
13	PDB:2zv6B	0.938	0.950	7.209E-48	371	0.460	0.466	2zv6B.pdb.gz
14	PDB:2arqA	0.896	0.935	6.815E-47	360	0.449	0.469	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
15	PDB:1xqgA	0.912	0.907	2.953E-44	378	0.346	0.344	1xqgA.pdb.gz
16	PDB:2ol2A	0.891	0.929	4.822E-43	360	0.338	0.353	2ol2A.pdb.gz
17	PDB:1hp7A	0.901	0.901	3.576E-42	376	0.340	0.340	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
18	PDB:1yxaA	0.890	0.900	1.734E-41	372	0.372	0.376	1yxaA.pdb.gz
19	PDB:4x30A	0.886	0.895	2.844E-39	372	0.287	0.290	4x30A.pdb.gz	Crystal structure of human Thyroxine-binding globulin complexed with thyroine at 1.55 Angstrom resolution
20	PDB:3f1sA	0.905	0.885	4.350E-39	385	0.306	0.299	3f1sA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024QZT4	0.0	780	376	1.000	1.000	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
2	O08797	0.0	530	374	0.686	0.690	O08797_MOUSE SPI6 OS=Mus musculus OX=10090 GN=Serpinb9 PE=1 SV=1
3	P50453	0.0	780	376	1.000	1.000	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
4	Q80UK5	7.61e-175	493	377	0.633	0.631	Q80UK5_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9f OS=Mus musculus OX=10090 GN=Serpinb9f PE=2 SV=1
5	Q6P217	3.57e-171	484	377	0.665	0.663	Q6P217_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9b OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
6	Q9DAV6	5.30e-171	483	377	0.665	0.663	Q9DAV6_MOUSE R86 OS=Mus musculus OX=10090 GN=Serpinb9b PE=1 SV=1
7	Q3TJ69	7.80e-170	480	377	0.662	0.660	Q3TJ69_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
8	P35237	2.28e-166	471	376	0.633	0.633	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
9	P50452	6.60e-164	465	374	0.628	0.631	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
10	Q60854	5.87e-163	463	378	0.620	0.616	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
11	O08804	3.10e-149	428	377	0.574	0.573	O08804_MOUSE NK13 OS=Mus musculus OX=10090 GN=Serpinb6b PE=1 SV=2
12	P30740	6.78e-127	371	379	0.513	0.509	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
13	V9HWH1	6.78e-127	371	379	0.513	0.509	V9HWH1_HUMAN Epididymis luminal protein 57 OS=Homo sapiens OX=9606 GN=HEL57 PE=2 SV=1
14	Q9D154	2.09e-122	360	379	0.487	0.483	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
15	P48595	2.12e-118	350	397	0.471	0.446	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
16	Q8BHL1	3.85e-118	349	387	0.473	0.460	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
17	Q6UKZ2	1.47e-117	348	387	0.473	0.460	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
18	P05120	3.13e-117	348	415	0.463	0.419	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
19	Q8VHP7	3.19e-116	344	382	0.487	0.479	ILEUB_MOUSE Leukocyte elastase inhibitor B OS=Mus musculus OX=10090 GN=Serpinb1b PE=1 SV=1
20	Q9D1Q5	1.23e-115	343	387	0.468	0.455	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19068 DUF5764	6.3e+02	11.7	Family of unknown function (DUF5764)
2	PF00079 Serpin	3.7e-126	433.0	Serpin (serine protease inhibitor)
3	PF13848 Thioredoxin_6	2.7e+02	12.8	Thioredoxin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370074

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216341	0.971	Granzyme B
2	9606.ENSP00000216336	0.850	Cathepsin G
3	9606.ENSP00000433138	0.771	Caspase-1
4	9606.ENSP00000298110	0.658	Probable G-protein coupled receptor 101
5	9606.ENSP00000357069	0.642	GPI mannosyltransferase 1
6	9606.ENSP00000388566	0.589	Caspase-4
7	9606.ENSP00000398568	0.521	Perforin-1
8	9606.ENSP00000351273	0.508	Caspase-8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0019899	0.317	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0050896	0.983	response to stimulus
GO:0050794	0.971	regulation of cellular process
GO:0048519	0.967	negative regulation of biological process
GO:0019222	0.965	regulation of metabolic process
GO:0009987	0.943	cellular process
GO:0060255	0.939	regulation of macromolecule metabolic process
GO:0031341	0.892	regulation of cell killing
GO:0002682	0.873	regulation of immune system process
GO:0009892	0.861	negative regulation of metabolic process
GO:0002252	0.849	immune effector process
GO:0030162	0.819	regulation of proteolysis
GO:0051336	0.812	regulation of hydrolase activity
GO:0048523	0.810	negative regulation of cellular process
GO:0051248	0.803	negative regulation of protein metabolic process
GO:0044092	0.797	negative regulation of molecular function
GO:0002443	0.793	leukocyte mediated immunity
GO:0002697	0.775	regulation of immune effector process
GO:0048583	0.720	regulation of response to stimulus
GO:0043086	0.708	negative regulation of catalytic activity
GO:0052547	0.707	regulation of peptidase activity
GO:0002703	0.706	regulation of leukocyte mediated immunity
GO:0051716	0.695	cellular response to stimulus
GO:0051346	0.650	negative regulation of hydrolase activity
GO:0010466	0.619	negative regulation of peptidase activity
GO:0001910	0.562	regulation of leukocyte mediated cytotoxicity
GO:0048518	0.512	positive regulation of biological process
GO:0031347	0.472	regulation of defense response
GO:0006955	0.465	immune response
GO:0043067	0.458	regulation of programmed cell death
GO:0032101	0.430	regulation of response to external stimulus
GO:0010468	0.409	regulation of gene expression
GO:0032501	0.385	multicellular organismal process
GO:0048522	0.349	positive regulation of cellular process
GO:0002683	0.349	negative regulation of immune system process
GO:0051239	0.340	regulation of multicellular organismal process
GO:0042221	0.327	response to chemical
GO:0010033	0.323	response to organic substance
GO:0052548	0.320	regulation of endopeptidase activity
GO:0042981	0.319	regulation of apoptotic process
GO:0050776	0.318	regulation of immune response
GO:0070887	0.316	cellular response to chemical stimulus
GO:0006950	0.300	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005829	0.991	cytosol
GO:0012505	0.984	endomembrane system
GO:0005654	0.981	nucleoplasm
GO:0005576	0.960	extracellular region
GO:0071944	0.950	cell periphery
GO:0016020	0.937	membrane
GO:0005615	0.814	extracellular space
GO:0005794	0.704	Golgi apparatus
GO:0031982	0.642	vesicle
GO:0031012	0.431	extracellular matrix
GO:0062023	0.375	collagen-containing extracellular matrix
GO:0005886	0.321	plasma membrane
GO:1903561	0.311	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]