StarFunc result for job id P50458

User Input

>input (406 residues)
MLFHSLSGPEVHGVIDEMDRRAKSEAPAISSAIDRGDTETTMPSISSDRAALCAGCGGKI
SDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYRRFSVQRCARCHL
GISASEMVMRARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEALLQGEYPAH
FNHADVAAAAAAAAAAKSAGLGAAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADLAAY
NAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA
QKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKSTDAALQTGTPSGPASELSNASLSP
SSTPTTLTDLTSPTLPTVTSVLTSVPGNLEGHEPHSPSQTTLTNLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P36198	0.379	0.362	1.128E-58	426	0.897	0.854	P36198.pdb.gz	LHX2_RAT LIM/homeobox protein Lhx2 OS=Rattus norvegicus OX=10116 GN=Lhx2 PE=2 SV=1
2	AFDB:O42108	0.390	0.395	2.107E-57	400	0.894	0.907	O42108.pdb.gz	O42108_CHICK LIM homeodomain OS=Gallus gallus OX=9031 GN=LH-2A PE=2 SV=1
3	AFDB:B0R107	0.388	0.371	3.080E-54	427	0.830	0.789	B0R107.pdb.gz	B0R107_DANRE LIM homeobox 2b OS=Danio rerio OX=7955 GN=bel PE=4 SV=1
4	AFDB:Q90881	0.378	0.386	3.557E-44	397	0.660	0.675	Q90881.pdb.gz	LHX9_CHICK LIM/homeobox protein Lhx9 OS=Gallus gallus OX=9031 GN=LHX9 PE=2 SV=2
5	AFDB:P29673	0.297	0.258	1.731E-30	469	0.419	0.362	P29673.pdb.gz	APTE_DROME Protein apterous OS=Drosophila melanogaster OX=7227 GN=ap PE=2 SV=1
6	AFDB:Q9R1R0	0.263	0.290	1.208E-23	363	0.261	0.292	Q9R1R0.pdb.gz	LHX6_MOUSE LIM/homeobox protein Lhx6 OS=Mus musculus OX=10090 GN=Lhx6 PE=1 SV=2
7	AFDB:O35652	0.277	0.302	1.988E-23	367	0.268	0.297	O35652.pdb.gz	LHX8_MOUSE LIM/homeobox protein Lhx8 OS=Mus musculus OX=10090 GN=Lhx8 PE=2 SV=4
8	AFDB:G5EC36	0.265	0.244	2.396E-23	452	0.266	0.239	G5EC36.pdb.gz	LIM7_CAEEL LIM/homeobox protein lim-7 OS=Caenorhabditis elegans OX=6239 GN=lim-7 PE=1 SV=1
9	AFDB:Q96A47	0.260	0.287	5.395E-22	359	0.273	0.309	Q96A47.pdb.gz	ISL2_HUMAN Insulin gene enhancer protein ISL-2 OS=Homo sapiens OX=9606 GN=ISL2 PE=1 SV=1
10	AFDB:P53407	0.253	0.282	7.367E-22	358	0.278	0.316	P53407.pdb.gz	ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio rerio OX=7955 GN=isl2b PE=2 SV=1
11	PDB:4kfzB	0.175	0.423	2.357E-12	148	0.118	0.324	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:1b8tA	0.148	0.297	4.741E-5	192	0.094	0.198	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
13	PDB:1imlA	0.142	0.635	2.553E-3	76	0.042	0.224	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4egcA	0.115	0.087	1.554E-2	539	0.034	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
15	PDB:4wa6D	0.076	0.075	6.130E-1	415	0.027	0.027	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
16	PDB:4r8pL	0.080	0.115	1.074	254	0.037	0.059	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
17	PDB:3mhsA	0.076	0.069	2.002	455	0.027	0.024	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
18	PDB:7uhyA	0.051	0.032	2.131	771	0.039	0.021	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
19	PDB:7uhyD	0.073	0.097	2.131	288	0.039	0.056	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
20	PDB:5gm6a	0.083	0.235	2.413	123	0.032	0.106	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0R107	0.0	711	427	0.837	0.796	B0R107_DANRE LIM homeobox 2b OS=Danio rerio OX=7955 GN=bel PE=4 SV=1
2	C4TJC6	0.0	847	406	0.998	0.998	C4TJC6_PIG LIM homeobox 2 OS=Sus scrofa OX=9823 GN=LHX2 PE=2 SV=1
3	F6Z9H5	0.0	759	365	0.889	0.989	F6Z9H5_MOUSE LIM homeobox protein 2 OS=Mus musculus OX=10090 GN=Lhx2 PE=1 SV=2
4	O42108	0.0	763	400	0.894	0.907	O42108_CHICK LIM homeodomain OS=Gallus gallus OX=9031 GN=LH-2A PE=2 SV=1
5	P36198	0.0	738	426	0.897	0.854	LHX2_RAT LIM/homeobox protein Lhx2 OS=Rattus norvegicus OX=10116 GN=Lhx2 PE=2 SV=1
6	P50458	0.0	849	406	1.000	1.000	LHX2_HUMAN LIM/homeobox protein Lhx2 OS=Homo sapiens OX=9606 GN=LHX2 PE=1 SV=2
7	Q1LWV4	0.0	580	396	0.697	0.715	LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio OX=7955 GN=lhx9 PE=2 SV=1
8	Q90881	0.0	577	397	0.700	0.715	LHX9_CHICK LIM/homeobox protein Lhx9 OS=Gallus gallus OX=9031 GN=LHX9 PE=2 SV=2
9	Q9NQ69	0.0	576	397	0.704	0.720	LHX9_HUMAN LIM/homeobox protein Lhx9 OS=Homo sapiens OX=9606 GN=LHX9 PE=1 SV=3
10	Q9WUH2	0.0	566	397	0.700	0.715	LHX9_MOUSE LIM/homeobox protein Lhx9 OS=Mus musculus OX=10090 GN=Lhx9 PE=1 SV=3
11	Q9Z0S2	0.0	844	406	0.990	0.990	LHX2_MOUSE LIM/homeobox protein Lhx2 OS=Mus musculus OX=10090 GN=Lhx2 PE=1 SV=1
12	P29673	1.12e-95	296	469	0.377	0.326	APTE_DROME Protein apterous OS=Drosophila melanogaster OX=7227 GN=ap PE=2 SV=1
13	Q9R1R0	5.14e-52	179	363	0.256	0.287	LHX6_MOUSE LIM/homeobox protein Lhx6 OS=Mus musculus OX=10090 GN=Lhx6 PE=1 SV=2
14	Q9UPM6	3.98e-51	177	363	0.259	0.289	LHX6_HUMAN LIM/homeobox protein Lhx6 OS=Homo sapiens OX=9606 GN=LHX6 PE=1 SV=2
15	Q96A47	9.93e-51	176	359	0.264	0.298	ISL2_HUMAN Insulin gene enhancer protein ISL-2 OS=Homo sapiens OX=9606 GN=ISL2 PE=1 SV=1
16	P53407	2.72e-50	175	358	0.264	0.299	ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio rerio OX=7955 GN=isl2b PE=2 SV=1
17	Q9CXV0	3.00e-50	175	359	0.261	0.295	ISL2_MOUSE Insulin gene enhancer protein ISL-2 OS=Mus musculus OX=10090 GN=Isl2 PE=1 SV=2
18	P53406	2.34e-49	172	359	0.256	0.290	ISL2A_DANRE Insulin gene enhancer protein isl-2a OS=Danio rerio OX=7955 GN=isl2a PE=2 SV=1
19	P29674	4.26e-48	170	403	0.244	0.246	LHX1_XENLA LIM/homeobox protein Lhx1 OS=Xenopus laevis OX=8355 GN=lhx1 PE=1 SV=1
20	G5EE86	4.81e-48	170	409	0.251	0.249	TTX3_CAEEL LIM/homeobox protein ttx-3 OS=Caenorhabditis elegans OX=6239 GN=ttx-3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07013 DUF1314	2.8	19.3	Protein of unknown function (DUF1314)
2	PF05920 Homeobox_KN	0.031	25.5	Homeobox KN domain
3	PF00046 Homeodomain	1.7e-15	67.9	Homeodomain
4	PF00412 LIM	5.6e-28	108.3	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362717

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392466	0.983	LIM domain-binding protein 1
2	9606.ENSP00000444198	0.969	Cbp/p300-interacting transactivator 2
3	9606.ENSP00000417335	0.928	Roundabout homolog 2
4	9606.ENSP00000420321	0.917	Roundabout homolog 1
5	9606.ENSP00000306772	0.872	LIM domain-binding protein 2
6	9606.ENSP00000260653	0.840	Homeobox protein SIX3
7	9606.ENSP00000328596	0.835	Homeobox protein SIX6
8	9606.ENSP00000338207	0.799	Rhombotin-1
9	9606.ENSP00000372170	0.785	Homeobox protein MSX-1
10	9606.ENSP00000339004	0.741	Forkhead box protein G1
11	9606.ENSP00000323588	0.721	Transcription factor SOX-2
12	9606.ENSP00000442786	0.717	LIM domain only protein 3
13	9606.ENSP00000328059	0.712	E3 ubiquitin-protein ligase RLIM
14	9606.ENSP00000374205	0.696	T-box brain protein 1
15	9606.ENSP00000354478	0.676	Homeobox protein DLX-1
16	9606.ENSP00000362734	0.672	Protein crumbs homolog 2
17	9606.ENSP00000266744	0.634	Achaete-scute homolog 1
18	9606.ENSP00000317333	0.623	Neurogenin-2
19	9606.ENSP00000322898	0.615	Transcription factor COE1
20	9606.ENSP00000282549	0.613	Homeobox protein OTX1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0000977	0.987	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140110	0.968	transcription regulator activity
GO:0003700	0.917	DNA-binding transcription factor activity
GO:0000981	0.693	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.569	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0010468	0.980	regulation of gene expression
GO:0050794	0.919	regulation of cellular process
GO:0032502	0.905	developmental process
GO:0006357	0.903	regulation of transcription by RNA polymerase II
GO:0048856	0.893	anatomical structure development
GO:0048518	0.891	positive regulation of biological process
GO:0032501	0.870	multicellular organismal process
GO:0007275	0.851	multicellular organism development
GO:0009987	0.830	cellular process
GO:0048731	0.815	system development
GO:0048522	0.815	positive regulation of cellular process
GO:0009893	0.768	positive regulation of metabolic process
GO:0007399	0.697	nervous system development
GO:0010604	0.664	positive regulation of macromolecule metabolic process
GO:0031325	0.564	positive regulation of cellular metabolic process
GO:0051173	0.562	positive regulation of nitrogen compound metabolic process
GO:0045935	0.541	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.526	response to stimulus
GO:0009891	0.517	positive regulation of biosynthetic process
GO:0048869	0.485	cellular developmental process
GO:0030154	0.484	cell differentiation
GO:0031328	0.475	positive regulation of cellular biosynthetic process
GO:0010557	0.474	positive regulation of macromolecule biosynthetic process
GO:0048513	0.470	animal organ development
GO:0045893	0.457	positive regulation of DNA-templated transcription
GO:0045944	0.444	positive regulation of transcription by RNA polymerase II
GO:0009653	0.303	anatomical structure morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]