StarFunc result for job id P50461

User Input

>input (194 residues)
MPNWGGGAKCGACEKTVYHAEEIQCNGRSFHKTCFHCMACRKALDSTTVAAHESEIYCKV
CYGRRYGPKGIGYGQGAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKC
PRCGKSVYAAEKVMGGGKPWHKTCFRCAICGKSLESTNVTDKDGELYCKVCYAKNFGPTG
IGFGGLTQQVEKKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2TDB8	0.422	0.422	5.627E-37	194	1.000	1.000	A2TDB8.pdb.gz	A2TDB8_HUMAN Cysteine and glycine-rich protein 3 (Cardiac LIM protein) OS=Homo sapiens OX=9606 GN=CSRP3 PE=2 SV=1
2	AFDB:Q05158	0.432	0.432	5.251E-31	194	0.670	0.670	Q05158.pdb.gz	CSRP2_COTJA Cysteine and glycine-rich protein 2 OS=Coturnix japonica OX=93934 GN=CSRP2 PE=1 SV=2
3	AFDB:F1QJC0	0.417	0.419	9.230E-30	193	0.722	0.725	F1QJC0.pdb.gz	F1QJC0_DANRE Cysteine and glycine-rich protein 3 (cardiac LIM protein) OS=Danio rerio OX=7955 GN=csrp3b PE=1 SV=1
4	AFDB:P21291	0.455	0.457	1.278E-29	193	0.660	0.663	P21291.pdb.gz	CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3
5	AFDB:Q6NZV4	0.411	0.415	9.026E-29	192	0.624	0.630	Q6NZV4.pdb.gz	Q6NZV4_DANRE Cysteine and glycine-rich protein 1 OS=Danio rerio OX=7955 GN=csrp1 PE=1 SV=1
6	PDB:1b8tA	0.326	0.329	5.188E-22	192	0.619	0.625	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
7	AFDB:Q24400	0.403	0.202	6.624E-21	495	0.438	0.172	Q24400.pdb.gz	MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster OX=7227 GN=Mlp84B PE=1 SV=1
8	AFDB:B0JZM5	0.352	0.336	3.370E-17	206	0.412	0.388	B0JZM5.pdb.gz
9	AFDB:Q6Q6R5	0.395	0.360	2.089E-16	217	0.325	0.290	Q6Q6R5.pdb.gz	CRIP3_HUMAN Cysteine-rich protein 3 OS=Homo sapiens OX=9606 GN=CRIP3 PE=1 SV=2
10	AFDB:P52943	0.403	0.383	3.295E-16	208	0.371	0.346	P52943.pdb.gz	CRIP2_HUMAN Cysteine-rich protein 2 OS=Homo sapiens OX=9606 GN=CRIP2 PE=1 SV=1
11	AFDB:Q94JX5	0.358	0.364	5.199E-16	190	0.294	0.300	Q94JX5.pdb.gz	WLIM1_ARATH LIM domain-containing protein WLIM1 OS=Arabidopsis thaliana OX=3702 GN=WLIM1 PE=1 SV=1
12	PDB:4kfzB	0.290	0.369	1.427E-8	148	0.139	0.182	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
13	PDB:1imlA	0.298	0.695	1.075E-7	76	0.175	0.447	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
14	PDB:4kblA	0.171	0.100	3.038E-1	395	0.155	0.076	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
15	PDB:7a1gM	0.140	0.449	3.461E-1	53	0.052	0.189	7a1gM.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.
16	PDB:7uhyD	0.209	0.147	3.694E-1	288	0.093	0.062	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:7od1A	0.148	0.074	6.639E-1	430	0.119	0.053	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:7oniH	0.141	0.073	9.814E-1	380	0.031	0.016	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
19	PDB:4r8pL	0.159	0.126	1.118	254	0.072	0.055	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:7b5lH	0.144	0.068	1.274	423	0.036	0.017	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2TDB8	1.90e-143	399	194	1.000	1.000	A2TDB8_HUMAN Cysteine and glycine-rich protein 3 (Cardiac LIM protein) OS=Homo sapiens OX=9606 GN=CSRP3 PE=2 SV=1
2	P50461	1.90e-143	399	194	1.000	1.000	CSRP3_HUMAN Cysteine and glycine-rich protein 3 OS=Homo sapiens OX=9606 GN=CSRP3 PE=1 SV=1
3	P50462	1.48e-141	394	194	0.979	0.979	CSRP3_MOUSE Cysteine and glycine-rich protein 3 OS=Mus musculus OX=10090 GN=Csrp3 PE=1 SV=1
4	P50463	2.39e-138	385	194	0.959	0.959	CSRP3_RAT Cysteine and glycine-rich protein 3 OS=Rattus norvegicus OX=10116 GN=Csrp3 PE=1 SV=1
5	Q05158	8.02e-96	278	194	0.670	0.670	CSRP2_COTJA Cysteine and glycine-rich protein 2 OS=Coturnix japonica OX=93934 GN=CSRP2 PE=1 SV=2
6	F1QJC0	1.65e-94	275	193	0.716	0.720	F1QJC0_DANRE Cysteine and glycine-rich protein 3 (cardiac LIM protein) OS=Danio rerio OX=7955 GN=csrp3b PE=1 SV=1
7	P97314	1.88e-91	267	193	0.655	0.658	CSRP2_MOUSE Cysteine and glycine-rich protein 2 OS=Mus musculus OX=10090 GN=Csrp2 PE=1 SV=3
8	Q16527	2.95e-91	266	193	0.655	0.658	CSRP2_HUMAN Cysteine and glycine-rich protein 2 OS=Homo sapiens OX=9606 GN=CSRP2 PE=1 SV=3
9	Q62908	4.83e-91	266	193	0.649	0.653	CSRP2_RAT Cysteine and glycine-rich protein 2 OS=Rattus norvegicus OX=10116 GN=Csrp2 PE=1 SV=3
10	P97315	6.72e-88	258	193	0.634	0.637	CSRP1_MOUSE Cysteine and glycine-rich protein 1 OS=Mus musculus OX=10090 GN=Csrp1 PE=1 SV=3
11	P21291	1.16e-87	257	193	0.634	0.637	CSRP1_HUMAN Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3
12	P67966	7.02e-85	250	192	0.624	0.630	CSRP1_CHICK Cysteine and glycine-rich protein 1 OS=Gallus gallus OX=9031 GN=CSRP1 PE=1 SV=2
13	Q6NZV4	2.83e-78	234	192	0.624	0.630	Q6NZV4_DANRE Cysteine and glycine-rich protein 1 OS=Danio rerio OX=7955 GN=csrp1 PE=1 SV=1
14	Q24400	5.98e-43	151	495	0.423	0.166	MLP2_DROME Muscle LIM protein Mlp84B OS=Drosophila melanogaster OX=7227 GN=Mlp84B PE=1 SV=1
15	F1QZB0	1.15e-35	125	206	0.407	0.383	F1QZB0_DANRE Cysteine-rich protein 2 OS=Danio rerio OX=7955 GN=wu:fb30h10 PE=1 SV=1
16	P52943	3.88e-31	114	208	0.381	0.356	CRIP2_HUMAN Cysteine-rich protein 2 OS=Homo sapiens OX=9606 GN=CRIP2 PE=1 SV=1
17	Q9DCT8	1.28e-30	113	208	0.381	0.356	CRIP2_MOUSE Cysteine-rich protein 2 OS=Mus musculus OX=10090 GN=Crip2 PE=1 SV=1
18	H2KZV8	5.24e-29	105	113	0.284	0.487	H2KZV8_CAEEL LIM zinc-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mlp-1 PE=1 SV=1
19	Q6Q6R3	2.41e-28	107	204	0.345	0.328	CRIP3_MOUSE Cysteine-rich protein 3 OS=Mus musculus OX=10090 GN=Crip3 PE=2 SV=2
20	Q9GP94	2.61e-28	103	95	0.247	0.505	Q9GP94_CAEEL LIM zinc-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mlp-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12514 DUF3718	88	14.8	Protein of unknown function (DUF3718)
2	PF00412 LIM	1.9e-25	100.2	LIM domain
3	PF17848 zf-ACC	1.5e+02	13.9	Acetyl-coA carboxylase zinc finger domain
4	PF06827 zf-FPG_IleRS	44	15.3	Zinc finger found in FPG and IleRS
5	PF12674 Zn_ribbon_2	1.3e+02	14.6	Putative zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312624	0.995	Telethonin
2	9606.ENSP00000250003	0.966	Myoblast determination protein 1
3	9606.ENSP00000467141	0.966	Titin
4	9606.ENSP00000324422	0.945	Zyxin
5	9606.ENSP00000306997	0.909	Myozenin-2
6	9606.ENSP00000357633	0.907	Glutaredoxin-3
7	9606.ENSP00000443495	0.886	Alpha-actinin-2
8	9606.ENSP00000228841	0.850	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
9	9606.ENSP00000442795	0.825	Myosin-binding protein C, cardiac-type
10	9606.ENSP00000401437	0.796	LIM domain-binding protein 3
11	9606.ENSP00000241651	0.785	Myogenin
12	9606.ENSP00000411932	0.784	Leiomodin-2
13	9606.ENSP00000298159	0.778	Cofilin-2
14	9606.ENSP00000451752	0.778	Spectrin beta chain, erythrocytic
15	9606.ENSP00000236918	0.768	Troponin T, cardiac muscle
16	9606.ENSP00000483018	0.768	Histo-blood group ABO system transferase
17	9606.ENSP00000379210	0.758	Myosin light chain 3
18	9606.ENSP00000386041	0.744	Myosin-6
19	9606.ENSP00000347507	0.730	Myosin-7
20	9606.ENSP00000306163	0.724	Ankyrin repeat domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008307	0.999	structural constituent of muscle
GO:0008092	0.989	cytoskeletal protein binding
GO:0043167	0.803	ion binding
GO:0097159	0.799	organic cyclic compound binding
GO:1901363	0.783	heterocyclic compound binding
GO:0046872	0.755	metal ion binding
GO:0046914	0.723	transition metal ion binding
GO:0008270	0.713	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0003008	0.985	system process
GO:0050789	0.981	regulation of biological process
GO:0003015	0.978	heart process
GO:0009612	0.977	response to mechanical stimulus
GO:0060047	0.974	heart contraction
GO:0050794	0.959	regulation of cellular process
GO:0048856	0.955	anatomical structure development
GO:0061061	0.940	muscle structure development
GO:0003012	0.903	muscle system process
GO:0055001	0.850	muscle cell development
GO:0060537	0.848	muscle tissue development
GO:0048518	0.795	positive regulation of biological process
GO:0031032	0.786	actomyosin structure organization
GO:0019222	0.776	regulation of metabolic process
GO:0060255	0.756	regulation of macromolecule metabolic process
GO:0048522	0.752	positive regulation of cellular process
GO:0009653	0.731	anatomical structure morphogenesis
GO:0080090	0.726	regulation of primary metabolic process
GO:0051171	0.726	regulation of nitrogen compound metabolic process
GO:0031323	0.725	regulation of cellular metabolic process
GO:0010468	0.725	regulation of gene expression
GO:0048513	0.715	animal organ development
GO:0097435	0.712	supramolecular fiber organization
GO:0022607	0.711	cellular component assembly
GO:0051146	0.668	striated muscle cell differentiation
GO:0051252	0.665	regulation of RNA metabolic process
GO:0048646	0.660	anatomical structure formation involved in morphogenesis
GO:0050793	0.659	regulation of developmental process
GO:0006936	0.655	muscle contraction
GO:0070925	0.645	organelle assembly
GO:0009889	0.587	regulation of biosynthetic process
GO:0045595	0.584	regulation of cell differentiation
GO:0140694	0.553	non-membrane-bounded organelle assembly
GO:0055002	0.552	striated muscle cell development
GO:0032989	0.531	cellular component morphogenesis
GO:0007275	0.368	multicellular organism development
GO:0010927	0.337	cellular component assembly involved in morphogenesis
GO:0006941	0.335	striated muscle contraction
GO:0030239	0.334	myofibril assembly
GO:0051239	0.327	regulation of multicellular organismal process
GO:0051716	0.314	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030016	0.995	myofibril
GO:0030017	0.993	sarcomere
GO:0005829	0.984	cytosol
GO:0031981	0.977	nuclear lumen
GO:0031674	0.949	I band
GO:0030018	0.935	Z disc
GO:0005654	0.921	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]