StarFunc result for job id P50548

User Input

>input (548 residues)
MKTPADTGFAFPDWAYKPESSPGSRQIQLWHFILELLRKEEYQGVIAWQGDYGEFVIKDP
DEVARLWGVRKCKPQMNYDKLSRALRYYYNKRILHKTKGKRFTYKFNFNKLVLVNYPFID
VGLAGGAVPQSAPPVPSGGSHFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARR
LGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRG
GPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSGGGGPSGSGGG
SHFSFSPEDMKRYLQAHTQSVYNYHLSPRAFLHYPGLVVPQPQRPDKCPLPPMAPETPPV
PSSASSSSSSSSSPFKFKLQPPPLGRRQRAAGEKAVAGADKSGGSAGGLAEGAGALAPPP
PPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKTPRAPPAPPKPEPGEAPGASQCMPL
KLRFKRRWSEDCRLEGGGGPAGGFEDEGEDKKVRGEGPGEAGGPLTPRRVSSDLQHATAQ
LSLEHRDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70459	0.368	0.367	1.475E-68	551	0.969	0.964	P70459.pdb.gz	ERF_MOUSE ETS domain-containing transcription factor ERF OS=Mus musculus OX=10090 GN=Erf PE=1 SV=1
2	AFDB:Q8R4Z4	0.173	0.185	1.852E-29	513	0.438	0.468	Q8R4Z4.pdb.gz	ETV3_MOUSE ETS translocation variant 3 OS=Mus musculus OX=10090 GN=Etv3 PE=1 SV=2
3	AFDB:P41162	0.176	0.187	6.924E-29	512	0.434	0.465	P41162.pdb.gz	ETV3_HUMAN ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2
4	AFDB:P41969	0.150	0.192	2.231E-10	429	0.199	0.254	P41969.pdb.gz	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3
5	AFDB:A0A024R985	0.159	0.201	6.182E-10	431	0.208	0.265	A0A024R985.pdb.gz
6	AFDB:G3V9V2	0.162	0.145	7.857E-10	615	0.173	0.154	G3V9V2.pdb.gz	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1
7	AFDB:Q9EQY2	0.161	0.153	2.311E-9	579	0.177	0.168	Q9EQY2.pdb.gz
8	AFDB:A0A024R1A7	0.150	0.192	2.766E-9	428	0.214	0.273	A0A024R1A7.pdb.gz
9	AFDB:Q9Z2U4	0.155	0.131	3.516E-9	655	0.181	0.151	Q9Z2U4.pdb.gz	ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2
10	AFDB:Q99607	0.158	0.131	4.744E-9	663	0.182	0.151	Q99607.pdb.gz	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
11	PDB:3cuqC	0.111	0.284	7.952E-1	173	0.029	0.092	3cuqC.pdb.gz
12	PDB:1ldjA	0.071	0.055	8.443E-1	725	0.016	0.012	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
13	PDB:4mtdD	0.102	0.298	8.443E-1	151	0.027	0.099	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
14	PDB:2xv4S	0.080	0.106	8.965E-1	399	0.011	0.015	2xv4S.pdb.gz
15	PDB:3m8eA	0.102	0.389	8.965E-1	101	0.020	0.109	3m8eA.pdb.gz
16	PDB:4v8mAD	0.069	0.312	8.965E-1	103	0.009	0.049	4v8mAD.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
17	PDB:5k1yD	0.071	0.307	1.011	92	0.016	0.098	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
18	PDB:7ff0A	0.107	0.254	1.011	206	0.022	0.058	7ff0A.pdb.gz	Inhibitory mechanism of gold analogues against Pseudomonas global virulence factor regulator Vfr
19	PDB:4xgcC	0.098	0.095	1.073	567	0.013	0.012	4xgcC.pdb.gz	Crystal structure of the eukaryotic origin recognition complex.
20	PDB:2zcwA	0.126	0.303	1.284	194	0.020	0.057	2zcwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50548	0.0	1087	548	1.000	1.000	ERF_HUMAN ETS domain-containing transcription factor ERF OS=Homo sapiens OX=9606 GN=ERF PE=1 SV=2
2	P70459	0.0	1045	551	0.969	0.964	ERF_MOUSE ETS domain-containing transcription factor ERF OS=Mus musculus OX=10090 GN=Erf PE=1 SV=1
3	P41162	1.20e-122	372	512	0.436	0.467	ETV3_HUMAN ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2
4	Q8R4Z4	1.16e-116	357	513	0.449	0.480	ETV3_MOUSE ETS translocation variant 3 OS=Mus musculus OX=10090 GN=Etv3 PE=1 SV=2
5	Q6ZN32	1.28e-65	219	361	0.182	0.277	ETV3L_HUMAN ETS translocation variant 3-like protein OS=Homo sapiens OX=9606 GN=ETV3L PE=1 SV=1
6	Q99581	1.52e-33	129	238	0.109	0.252	FEV_HUMAN Protein FEV OS=Homo sapiens OX=9606 GN=FEV PE=1 SV=1
7	O70132	1.81e-33	129	237	0.109	0.253	FEV_RAT Protein FEV OS=Rattus norvegicus OX=10116 GN=Fev PE=2 SV=2
8	Q8QZW2	1.81e-33	129	237	0.109	0.253	FEV_MOUSE Protein FEV OS=Mus musculus OX=10090 GN=Fev PE=2 SV=1
9	A3FEM2	3.91e-33	128	235	0.109	0.255	FEV_DANRE Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=1
10	Q9PU61	5.91e-32	130	451	0.113	0.137	Q9PU61_DANRE Fli-1 protein OS=Danio rerio OX=7955 GN=fli1a PE=1 SV=1
11	A0A2R8QGN6	6.12e-32	130	460	0.113	0.135	A0A2R8QGN6_DANRE Fli-1 proto-oncogene, ETS transcription factor a OS=Danio rerio OX=7955 GN=cb855 PE=1 SV=1
12	Q22355	6.19e-32	129	377	0.102	0.149	AST1_CAEEL Transcription factor ast-1 OS=Caenorhabditis elegans OX=6239 GN=ast-1 PE=1 SV=2
13	P26323	1.46e-31	129	452	0.128	0.155	FLI1_MOUSE Friend leukemia integration 1 transcription factor OS=Mus musculus OX=10090 GN=Fli1 PE=1 SV=1
14	Q5MBG6	1.59e-31	129	458	0.100	0.120	Q5MBG6_DANRE ETS family transcription factor efr1 OS=Danio rerio OX=7955 GN=fli1b PE=2 SV=1
15	Q01543	3.27e-31	128	452	0.111	0.135	FLI1_HUMAN Friend leukemia integration 1 transcription factor OS=Homo sapiens OX=9606 GN=FLI1 PE=1 SV=1
16	P11308	3.65e-31	128	479	0.131	0.150	ERG_HUMAN Transcriptional regulator ERG OS=Homo sapiens OX=9606 GN=ERG PE=1 SV=3
17	Q5PR65	3.92e-31	127	427	0.102	0.131	Q5PR65_DANRE Erg protein OS=Danio rerio OX=7955 GN=zgc:103429 PE=2 SV=1
18	P81270	3.96e-31	128	486	0.102	0.115	ERG_MOUSE Transcriptional regulator ERG OS=Mus musculus OX=10090 GN=Erg PE=1 SV=2
19	P29776	6.76e-30	124	475	0.099	0.114	ETS6_DROME DNA-binding protein D-ETS-6 OS=Drosophila melanogaster OX=7227 GN=Ets21C PE=2 SV=2
20	A0A590UJP9	3.60e-28	120	504	0.099	0.107	A0A590UJP9_HUMAN ETS proto-oncogene 2, transcription factor OS=Homo sapiens OX=9606 GN=ETS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	1.2e-27	107.4	Ets-domain
2	PF00447 HSF_DNA-bind	38	16.2	HSF-type DNA-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222329

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215832	0.961	Mitogen-activated protein kinase 1
2	9606.ENSP00000353344	0.919	Protein C-ets-2
3	9606.ENSP00000263025	0.917	Mitogen-activated protein kinase 3
4	9606.ENSP00000483552	0.594	Furin
5	9606.ENSP00000269305	0.575	Cellular tumor antigen p53
6	9606.ENSP00000245908	0.520	SH2 domain-containing protein 3A
7	9606.ENSP00000256442	0.509	G2/mitotic-specific cyclin-B1
8	9606.ENSP00000317817	0.506	SH2 domain-containing protein 3C
9	9606.ENSP00000482358	0.505	Serine protease 57

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0001227	0.971	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000976	0.961	transcription cis-regulatory region binding
GO:0000977	0.904	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0019899	0.811	enzyme binding
GO:0000978	0.637	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.375	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.987	regulation of gene expression
GO:0019219	0.985	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.983	regulation of DNA-templated transcription
GO:0009987	0.978	cellular process
GO:0006357	0.971	regulation of transcription by RNA polymerase II
GO:0048519	0.947	negative regulation of biological process
GO:0048523	0.940	negative regulation of cellular process
GO:0032501	0.781	multicellular organismal process
GO:0009892	0.779	negative regulation of metabolic process
GO:0032502	0.761	developmental process
GO:0051172	0.730	negative regulation of nitrogen compound metabolic process
GO:0048856	0.690	anatomical structure development
GO:0031324	0.651	negative regulation of cellular metabolic process
GO:0010605	0.633	negative regulation of macromolecule metabolic process
GO:0048518	0.626	positive regulation of biological process
GO:0048522	0.591	positive regulation of cellular process
GO:0009893	0.449	positive regulation of metabolic process
GO:0050896	0.442	response to stimulus
GO:0051173	0.435	positive regulation of nitrogen compound metabolic process
GO:0010558	0.427	negative regulation of macromolecule biosynthetic process
GO:0031327	0.427	negative regulation of cellular biosynthetic process
GO:0010604	0.422	positive regulation of macromolecule metabolic process
GO:0045934	0.417	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.396	negative regulation of RNA metabolic process
GO:0031325	0.380	positive regulation of cellular metabolic process
GO:0007275	0.378	multicellular organism development
GO:0045892	0.356	negative regulation of DNA-templated transcription
GO:0010557	0.315	positive regulation of macromolecule biosynthetic process
GO:0045935	0.315	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.305	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0016020	0.362	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]