StarFunc result for job id P50552

User Input

>input (380 residues)
MSETVICSSRATVMLYDDGNKRWLPAGTGPQAFSRVQIYHNPTANSFRVVGRKMQPDQQV
VINCAIVRGVKYNQATPNFHQWRDARQVWGLNFGSKEDAAQFAAGMASALEALEGGGPPP
PPALPTWSVPNGPSPEEVEQQKRQQPGPSEHIERRVSNAGGPPAPPAGGPPPPPGPPPPP
GPPPPPGLPPSGVPAAAHGAGGGPPPAPPLPAAQGPGGGGAGAPGLAAAIAGAKLRKVSK
QEEASGGPTAPKAESGRSGGGGLMEEMNAMLARRRKATQVGEKTPKDESANQEEPEARVP
AQSESVRRPWEKNSTTLPRMKSSSSVTTSETQPCTPSSSDYSDLQRVKQELLEEVKKELQ
KVKEEIIEAFVQELRKRGSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R0V4	0.339	0.339	4.551E-55	380	1.000	1.000	A0A024R0V4.pdb.gz	A0A024R0V4_HUMAN Vasodilator-stimulated phosphoprotein isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=VASP PE=2 SV=1
2	AFDB:P70460	0.385	0.389	2.212E-49	375	0.876	0.888	P70460.pdb.gz	VASP_MOUSE Vasodilator-stimulated phosphoprotein OS=Mus musculus OX=10090 GN=Vasp PE=1 SV=4
3	AFDB:O08719	0.307	0.280	5.586E-27	420	0.511	0.462	O08719.pdb.gz	EVL_RAT Ena/VASP-like protein OS=Rattus norvegicus OX=10116 GN=Evl PE=1 SV=2
4	AFDB:Q5TJ65	0.299	0.299	1.022E-19	380	0.350	0.350	Q5TJ65.pdb.gz	VASP_DICDI Protein VASP homolog OS=Dictyostelium discoideum OX=44689 GN=vasp PE=1 SV=1
5	AFDB:G5EG53	0.316	0.262	1.416E-17	468	0.303	0.246	G5EG53.pdb.gz	G5EG53_CAEEL UNC-34 OS=Caenorhabditis elegans OX=6239 GN=unc-34 PE=1 SV=1
6	AFDB:Q6P6N5	0.275	0.257	6.280E-11	408	0.187	0.174	Q6P6N5.pdb.gz	SPRE3_MOUSE Sprouty-related, EVH1 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Spred3 PE=1 SV=1
7	PDB:3m1iB	0.262	0.716	2.111E-7	131	0.063	0.183	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
8	AFDB:P91621	0.236	0.048	3.967E-6	2072	0.150	0.028	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
9	PDB:1k5dB	0.263	0.653	5.341E-6	146	0.053	0.137	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
10	AFDB:P49797	0.215	0.092	1.833E-5	967	0.161	0.063	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
11	AFDB:Q22354	0.222	0.105	4.053E-5	862	0.116	0.051	Q22354.pdb.gz	Q22354_CAEEL DH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rhgf-2 PE=1 SV=1
12	PDB:2qkmG	0.208	0.553	3.348E-4	127	0.045	0.134	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
13	AFDB:Q8C886	0.216	0.141	4.638E-4	610	0.129	0.080	Q8C886.pdb.gz	PKHN1_MOUSE Probable pleckstrin homology domain-containing family N member 1 OS=Mus musculus OX=10090 GN=Plekhn1 PE=1 SV=2
14	PDB:6oxlN	0.225	0.582	1.233E-3	124	0.042	0.129	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
15	PDB:1q67B	0.230	0.504	4.054E-3	161	0.032	0.075	1q67B.pdb.gz
16	PDB:4iapA	0.158	0.222	8.471E-3	256	0.029	0.043	4iapA.pdb.gz
17	PDB:5yqrA	0.190	0.259	1.770E-2	268	0.018	0.026	5yqrA.pdb.gz
18	PDB:4mt6A	0.183	0.179	2.487E-2	389	0.024	0.023	4mt6A.pdb.gz
19	PDB:7pgrN	0.179	0.034	3.120E-2	2423	0.032	0.005	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
20	PDB:4gouA	0.207	0.162	3.495E-2	507	0.032	0.024	4gouA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R0V4	0.0	751	380	1.000	1.000	A0A024R0V4_HUMAN Vasodilator-stimulated phosphoprotein isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=VASP PE=2 SV=1
2	P50552	0.0	751	380	1.000	1.000	VASP_HUMAN Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3
3	P70460	0.0	541	375	0.876	0.888	VASP_MOUSE Vasodilator-stimulated phosphoprotein OS=Mus musculus OX=10090 GN=Vasp PE=1 SV=4
4	Q9UI08	2.29e-82	259	416	0.503	0.459	EVL_HUMAN Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL PE=1 SV=2
5	O08719	1.26e-74	239	420	0.492	0.445	EVL_RAT Ena/VASP-like protein OS=Rattus norvegicus OX=10116 GN=Evl PE=1 SV=2
6	P70429	6.36e-74	237	414	0.489	0.449	EVL_MOUSE Ena/VASP-like protein OS=Mus musculus OX=10090 GN=Evl PE=1 SV=2
7	A0A4D6J698	2.12e-51	182	570	0.239	0.160	A0A4D6J698_HUMAN Mena delta 11a OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q8N8S7	2.88e-51	182	591	0.239	0.154	ENAH_HUMAN Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2
9	Q5XHX3	3.01e-51	181	526	0.237	0.171	Q5XHX3_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
10	A0A0G2K6I4	7.53e-51	180	563	0.237	0.160	A0A0G2K6I4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=2
11	A0A8I5ZND4	3.99e-50	179	570	0.237	0.158	A0A8I5ZND4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
12	A0A8I5Y4S4	6.58e-49	178	805	0.239	0.113	A0A8I5Y4S4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
13	A0A0U1RRM6	4.67e-48	176	802	0.239	0.113	A0A0U1RRM6_HUMAN ENAH actin regulator OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=1
14	A0A8I6G5W6	5.33e-48	176	788	0.239	0.115	A0A8I6G5W6_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
15	A0A8I6GMP8	9.35e-48	175	788	0.234	0.113	A0A8I6GMP8_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
16	A0A8I5ZT50	7.57e-47	172	803	0.205	0.097	A0A8I5ZT50_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
17	Q03173	8.46e-47	172	802	0.205	0.097	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
18	Q8T4F7	7.98e-41	155	980	0.221	0.086	ENA_DROME Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4
19	Q5TJ65	7.72e-20	92.0	380	0.113	0.113	VASP_DICDI Protein VASP homolog OS=Dictyostelium discoideum OX=44689 GN=vasp PE=1 SV=1
20	G5EG53	8.65e-20	92.8	468	0.111	0.090	G5EG53_CAEEL UNC-34 OS=Caenorhabditis elegans OX=6239 GN=unc-34 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08687 ASD2	4	18.5	Apx/Shroom domain ASD2
2	PF00638 Ran_BP1	39	15.9	RanBP1 domain
3	PF08776 VASP_tetra	8.4e-12	55.7	VASP tetramerisation domain
4	PF00568 WH1	3.5e-35	131.7	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324422	0.999	Zyxin
2	9606.ENSP00000211998	0.994	Vinculin
3	9606.ENSP00000225655	0.994	Profilin-1
4	9606.ENSP00000365411	0.994	Amyloid beta A4 precursor protein-binding family B member 1-interacting protein
5	9606.ENSP00000319635	0.993	C-X-C chemokine receptor type 2
6	9606.ENSP00000355645	0.991	Actin, alpha skeletal muscle
7	9606.ENSP00000416387	0.987	Filamin-binding LIM protein 1
8	9606.ENSP00000482472	0.986	Lipoma-preferred partner
9	9606.ENSP00000239940	0.984	Profilin-2
10	9606.ENSP00000316543	0.983	Ras-associated and pleckstrin homology domains-containing protein 1
11	9606.ENSP00000355809	0.975	Protein enabled homolog
12	9606.ENSP00000376652	0.974	Ena/VASP-like protein
13	9606.ENSP00000427114	0.964	FYN-binding protein 1
14	9606.ENSP00000383118	0.955	Cell division control protein 42 homolog
15	9606.ENSP00000344456	0.953	Catenin beta-1
16	9606.ENSP00000261769	0.951	Cadherin-1
17	9606.ENSP00000363092	0.951	cGMP-dependent protein kinase 1
18	9606.ENSP00000281537	0.949	Tight junction protein ZO-1
19	9606.ENSP00000316338	0.945	Brain-specific angiogenesis inhibitor 1-associated protein 2
20	9606.ENSP00000458162	0.936	Actin, cytoplasmic 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0051493	0.985	regulation of cytoskeleton organization
GO:0051130	0.985	positive regulation of cellular component organization
GO:0044087	0.984	regulation of cellular component biogenesis
GO:1902903	0.980	regulation of supramolecular fiber organization
GO:0032956	0.977	regulation of actin cytoskeleton organization
GO:0071840	0.975	cellular component organization or biogenesis
GO:0016043	0.974	cellular component organization
GO:0110053	0.968	regulation of actin filament organization
GO:1902905	0.956	positive regulation of supramolecular fiber organization
GO:0051495	0.942	positive regulation of cytoskeleton organization
GO:0050896	0.937	response to stimulus
GO:0044089	0.927	positive regulation of cellular component biogenesis
GO:0043254	0.910	regulation of protein-containing complex assembly
GO:0065008	0.845	regulation of biological quality
GO:0032501	0.813	multicellular organismal process
GO:0032502	0.780	developmental process
GO:0048856	0.773	anatomical structure development
GO:0030029	0.762	actin filament-based process
GO:0090066	0.656	regulation of anatomical structure size
GO:0032271	0.652	regulation of protein polymerization
GO:0008064	0.619	regulation of actin polymerization or depolymerization
GO:0030036	0.615	actin cytoskeleton organization
GO:0051716	0.596	cellular response to stimulus
GO:0007275	0.566	multicellular organism development
GO:0042221	0.538	response to chemical
GO:0009653	0.436	anatomical structure morphogenesis
GO:0031334	0.409	positive regulation of protein-containing complex assembly
GO:0030838	0.357	positive regulation of actin filament polymerization
GO:0048731	0.328	system development
GO:0009888	0.325	tissue development
GO:0009605	0.307	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005925	1.000	focal adhesion
GO:0005886	0.999	plasma membrane
GO:0043227	0.980	membrane-bounded organelle
GO:0043229	0.973	intracellular organelle
GO:0043232	0.902	intracellular non-membrane-bounded organelle
GO:0031982	0.862	vesicle
GO:0005576	0.836	extracellular region
GO:0043231	0.785	intracellular membrane-bounded organelle
GO:1903561	0.775	extracellular vesicle
GO:0070062	0.762	extracellular exosome
GO:0005856	0.759	cytoskeleton
GO:0015629	0.469	actin cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]