StarFunc result for job id P50553

User Input

>input (236 residues)
MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQ
QQAPQLRPAADGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAV
ARRNERERNRVKLVNLGFATLREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAV
SAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50553	1.000	1.000	1.119E-35	236	1.000	1.000	P50553.pdb.gz	ASCL1_HUMAN Achaete-scute homolog 1 OS=Homo sapiens OX=9606 GN=ASCL1 PE=1 SV=2
2	AFDB:Q90259	0.427	0.503	1.308E-22	196	0.720	0.867	Q90259.pdb.gz	ASL1A_DANRE Achaete-scute homolog 1a OS=Danio rerio OX=7955 GN=ascl1a PE=2 SV=1
3	AFDB:Q90260	0.371	0.434	2.330E-17	195	0.513	0.621	Q90260.pdb.gz	ASL1B_DANRE Achaete-scute homolog 1b OS=Danio rerio OX=7955 GN=ascl1b PE=2 SV=1
4	AFDB:O35885	0.311	0.280	4.472E-11	263	0.445	0.399	O35885.pdb.gz	ASCL2_MOUSE Achaete-scute homolog 2 OS=Mus musculus OX=10090 GN=Ascl2 PE=1 SV=2
5	AFDB:Q99929	0.312	0.379	3.206E-10	193	0.386	0.472	Q99929.pdb.gz	ASCL2_HUMAN Achaete-scute homolog 2 OS=Homo sapiens OX=9606 GN=ASCL2 PE=2 SV=2
6	AFDB:P19360	0.300	0.273	4.534E-9	260	0.398	0.362	P19360.pdb.gz	ASCL2_RAT Achaete-scute homolog 2 OS=Rattus norvegicus OX=10116 GN=Ascl2 PE=1 SV=1
7	AFDB:Q6XD76	0.261	0.351	4.039E-6	172	0.208	0.285	Q6XD76.pdb.gz	ASCL4_HUMAN Achaete-scute homolog 4 OS=Homo sapiens OX=9606 GN=ASCL4 PE=1 SV=1
8	AFDB:M0QWB7	0.280	0.340	4.658E-5	188	0.237	0.298	M0QWB7.pdb.gz	ASCL5_MOUSE Achaete-scute homolog 5 OS=Mus musculus OX=10090 GN=Ascl5 PE=1 SV=1
9	AFDB:Q9JJR7	0.227	0.304	1.693E-4	174	0.208	0.282	Q9JJR7.pdb.gz	ASCL3_MOUSE Achaete-scute homolog 3 OS=Mus musculus OX=10090 GN=Ascl3 PE=2 SV=1
10	AFDB:O73823	0.292	0.181	1.940E-4	394	0.237	0.142	O73823.pdb.gz	TAL1_XENLA T-cell acute lymphocytic leukemia protein 1 OS=Xenopus laevis OX=8355 GN=tal1 PE=2 SV=1
11	PDB:5n9jZ	0.124	0.229	2.042	119	0.076	0.151	5n9jZ.pdb.gz
12	PDB:4n78F	0.147	0.215	2.185	156	0.076	0.115	4n78F.pdb.gz	The WAVE Regulatory Complex Links Diverse Receptors to the Actin Cytoskeleton.
13	PDB:5x3xQ	0.145	0.141	3.516	243	0.072	0.070	5x3xQ.pdb.gz
14	PDB:7r5jV0	0.115	0.105	3.763	273	0.127	0.110	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:6mzcK	0.150	0.173	5.656	202	0.059	0.069	6mzcK.pdb.gz
16	PDB:3ojaA	0.226	0.121	6.934	482	0.038	0.019	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
17	PDB:6mzcM	0.139	0.272	7.943	104	0.072	0.163	6mzcM.pdb.gz
18	PDB:6qw65B	0.134	0.024	8.501	2001	0.097	0.011	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:1y11A	0.137	0.097	9.738	364	0.055	0.036	1y11A.pdb.gz
20	PDB:4jndA	0.096	0.063	9.738	408	0.042	0.025	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50553	4.29e-172	474	236	1.000	1.000	ASCL1_HUMAN Achaete-scute homolog 1 OS=Homo sapiens OX=9606 GN=ASCL1 PE=1 SV=2
2	P19359	1.75e-159	442	233	0.958	0.970	ASCL1_RAT Achaete-scute homolog 1 OS=Rattus norvegicus OX=10116 GN=Ascl1 PE=2 SV=1
3	Q02067	1.10e-113	327	231	0.708	0.723	ASCL1_MOUSE Achaete-scute homolog 1 OS=Mus musculus OX=10090 GN=Ascl1 PE=1 SV=2
4	Q90259	7.56e-102	295	196	0.720	0.867	ASL1A_DANRE Achaete-scute homolog 1a OS=Danio rerio OX=7955 GN=ascl1a PE=2 SV=1
5	Q90260	4.33e-72	220	195	0.508	0.615	ASL1B_DANRE Achaete-scute homolog 1b OS=Danio rerio OX=7955 GN=ascl1b PE=2 SV=1
6	Q99929	3.04e-35	125	193	0.377	0.461	ASCL2_HUMAN Achaete-scute homolog 2 OS=Homo sapiens OX=9606 GN=ASCL2 PE=2 SV=2
7	P19360	1.42e-27	107	260	0.275	0.250	ASCL2_RAT Achaete-scute homolog 2 OS=Rattus norvegicus OX=10116 GN=Ascl2 PE=1 SV=1
8	O35885	3.32e-26	104	263	0.280	0.251	ASCL2_MOUSE Achaete-scute homolog 2 OS=Mus musculus OX=10090 GN=Ascl2 PE=1 SV=2
9	Q6XD76	2.90e-17	78.6	172	0.144	0.198	ASCL4_HUMAN Achaete-scute homolog 4 OS=Homo sapiens OX=9606 GN=ASCL4 PE=1 SV=1
10	M0QWB7	1.77e-16	76.6	188	0.144	0.181	ASCL5_MOUSE Achaete-scute homolog 5 OS=Mus musculus OX=10090 GN=Ascl5 PE=1 SV=1
11	P10083	5.06e-16	75.9	201	0.174	0.204	AST5_DROME Achaete-scute complex protein T5 OS=Drosophila melanogaster OX=7227 GN=ac PE=1 SV=1
12	Q9NQ33	8.13e-16	74.7	180	0.161	0.211	ASCL3_HUMAN Achaete-scute homolog 3 OS=Homo sapiens OX=9606 GN=ASCL3 PE=1 SV=2
13	Q9JJR7	9.40e-16	74.3	174	0.144	0.195	ASCL3_MOUSE Achaete-scute homolog 3 OS=Mus musculus OX=10090 GN=Ascl3 PE=2 SV=1
14	Q22717	3.40e-14	70.1	170	0.199	0.276	HLH3_CAEEL Helix-loop-helix protein 3 OS=Caenorhabditis elegans OX=6239 GN=hlh-3 PE=1 SV=2
15	P10084	3.60e-14	72.8	345	0.169	0.116	AST4_DROME Achaete-scute complex protein T4 OS=Drosophila melanogaster OX=7227 GN=sc PE=1 SV=2
16	P09774	1.19e-11	64.7	257	0.199	0.183	AST3_DROME Achaete-scute complex protein T3 OS=Drosophila melanogaster OX=7227 GN=l(1)sc PE=2 SV=2
17	Q10007	2.28e-11	63.9	268	0.123	0.108	HLH6_CAEEL Helix-loop-helix protein 6 OS=Caenorhabditis elegans OX=6239 GN=hlh-6 PE=2 SV=1
18	Q10574	4.91e-11	60.8	142	0.157	0.261	LIN32_CAEEL Protein lin-32 OS=Caenorhabditis elegans OX=6239 GN=lin-32 PE=1 SV=2
19	P57102	2.94e-10	60.1	208	0.140	0.159	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
20	P61295	4.85e-10	59.7	217	0.161	0.175	HAND2_RAT Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20101 DUF6491	58	15.1	Family of unknown function (DUF6491)
2	PF00010 HLH	1.1e-14	65.4	Helix-loop-helix DNA-binding domain
3	PF03153 TFIIA	3.7e+02	12.5	Transcription factor IIA, alpha/beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266744

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388940	0.976	Transcription factor 12
2	9606.ENSP00000329170	0.963	POU domain, class 3, transcription factor 2
3	9606.ENSP00000262965	0.942	Transcription factor E2-alpha
4	9606.ENSP00000317333	0.940	Neurogenin-2
5	9606.ENSP00000381382	0.938	Transcription factor 4
6	9606.ENSP00000249330	0.908	Neurosecretory protein VGF
7	9606.ENSP00000396103	0.890	Myelin transcription factor 1-like protein
8	9606.ENSP00000263253	0.885	Histone acetyltransferase p300
9	9606.ENSP00000387699	0.843	Cyclic AMP-responsive element-binding protein 1
10	9606.ENSP00000302216	0.837	Protein atonal homolog 1
11	9606.ENSP00000365280	0.830	DNA-binding protein inhibitor ID-1
12	9606.ENSP00000355001	0.818	POU domain, class 3, transcription factor 3
13	9606.ENSP00000317580	0.809	Neurogenin-1
14	9606.ENSP00000232424	0.801	Transcription factor HES-1
15	9606.ENSP00000311816	0.794	RE1-silencing transcription factor
16	9606.ENSP00000323588	0.793	Transcription factor SOX-2
17	9606.ENSP00000234091	0.790	DNA-binding protein inhibitor ID-2
18	9606.ENSP00000331040	0.786	Oligodendrocyte transcription factor 2
19	9606.ENSP00000340226	0.775	LIM homeobox transcription factor 1-alpha
20	9606.ENSP00000354478	0.765	Homeobox protein DLX-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.997	transcription factor binding
GO:0000981	0.997	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0070888	0.985	E-box binding
GO:0140297	0.959	DNA-binding transcription factor binding
GO:0001217	0.887	DNA-binding transcription repressor activity
GO:0001227	0.873	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0043425	0.862	bHLH transcription factor binding
GO:0042802	0.555	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0032501	0.994	multicellular organismal process
GO:0048856	0.994	anatomical structure development
GO:0048522	0.992	positive regulation of cellular process
GO:0009987	0.990	cellular process
GO:0051252	0.989	regulation of RNA metabolic process
GO:0048523	0.983	negative regulation of cellular process
GO:2001141	0.974	regulation of RNA biosynthetic process
GO:0048731	0.968	system development
GO:0050896	0.957	response to stimulus
GO:0010468	0.955	regulation of gene expression
GO:0006355	0.952	regulation of DNA-templated transcription
GO:0048513	0.949	animal organ development
GO:0007399	0.941	nervous system development
GO:0010604	0.922	positive regulation of macromolecule metabolic process
GO:0051173	0.908	positive regulation of nitrogen compound metabolic process
GO:0045935	0.899	positive regulation of nucleobase-containing compound metabolic process
GO:0048869	0.896	cellular developmental process
GO:0051254	0.881	positive regulation of RNA metabolic process
GO:0031328	0.879	positive regulation of cellular biosynthetic process
GO:0030154	0.878	cell differentiation
GO:0051716	0.875	cellular response to stimulus
GO:0006357	0.874	regulation of transcription by RNA polymerase II
GO:0045893	0.873	positive regulation of DNA-templated transcription
GO:0007417	0.839	central nervous system development
GO:0050793	0.831	regulation of developmental process
GO:0045595	0.816	regulation of cell differentiation
GO:0030900	0.745	forebrain development
GO:0042221	0.663	response to chemical
GO:0010605	0.661	negative regulation of macromolecule metabolic process
GO:0010941	0.650	regulation of cell death
GO:0045664	0.650	regulation of neuron differentiation
GO:0048699	0.650	generation of neurons
GO:0030182	0.639	neuron differentiation
GO:0023052	0.608	signaling
GO:0007154	0.608	cell communication
GO:0010033	0.591	response to organic substance
GO:0021953	0.522	central nervous system neuron differentiation
GO:0045944	0.518	positive regulation of transcription by RNA polymerase II
GO:0032526	0.468	response to retinoic acid
GO:0051172	0.467	negative regulation of nitrogen compound metabolic process
GO:0031324	0.461	negative regulation of cellular metabolic process
GO:0051093	0.443	negative regulation of developmental process
GO:0000122	0.431	negative regulation of transcription by RNA polymerase II
GO:0045165	0.426	cell fate commitment
GO:0045596	0.421	negative regulation of cell differentiation
GO:0007165	0.364	signal transduction
GO:0045665	0.301	negative regulation of neuron differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.965	intracellular organelle lumen
GO:0005654	0.942	nucleoplasm
GO:0005737	0.651	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]