StarFunc result for job id P50583

User Input

>input (147 residues)
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQ
EEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLE
EACQLAQFKEMKAALQEGHQFLCSIEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50583	1.000	1.000	1.870E-32	147	1.000	1.000	P50583.pdb.gz	AP4A_HUMAN Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Homo sapiens OX=9606 GN=NUDT2 PE=1 SV=3
2	AFDB:P50584	0.982	0.982	1.523E-29	147	0.884	0.884	P50584.pdb.gz	AP4A_PIG Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Sus scrofa OX=9823 GN=NUDT2 PE=1 SV=3
3	AFDB:P56380	0.966	0.966	5.211E-29	147	0.884	0.884	P56380.pdb.gz	AP4A_MOUSE Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Mus musculus OX=10090 GN=Nudt2 PE=1 SV=3
4	PDB:1xscA	0.936	0.901	6.999E-28	153	0.993	0.954	1xscA.pdb.gz	Structure and Substrate-binding Mechanism of Human Ap4A Hydrolase
5	AFDB:Q9U2M7	0.905	0.962	5.209E-20	138	0.476	0.507	Q9U2M7.pdb.gz	AP4A_CAEEL Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Caenorhabditis elegans OX=6239 GN=ndx-4 PE=1 SV=1
6	PDB:1ktgA	0.891	0.955	3.783E-19	137	0.469	0.504	1ktgA.pdb.gz	The crystal structure of diadenosine tetraphosphate hydrolase from Caenorhabditis elegans in free and binary complex forms
7	AFDB:C0H4F3	0.923	0.893	1.097E-17	152	0.347	0.336	C0H4F3.pdb.gz	C0H4F3_PLAF7 Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0520600 PE=1 SV=1
8	PDB:5cfiA	0.877	0.877	2.410E-16	147	0.347	0.347	5cfiA.pdb.gz
9	AFDB:Q75UV1	0.746	0.863	1.675E-10	126	0.259	0.302	Q75UV1.pdb.gz	NDX1_THETH Diadenosine hexaphosphate hydrolase OS=Thermus thermophilus OX=274 GN=ndx1 PE=1 SV=1
10	PDB:1vc8A	0.741	0.857	2.615E-10	126	0.259	0.302	1vc8A.pdb.gz	Crystal Structure of Nudix Protein Ndx1 from Thermus thermophilus HB8 in binary complex with diadenosine hexaphosphate
11	PDB:2kdvA	0.731	0.664	1.871E-9	164	0.184	0.165	2kdvA.pdb.gz
12	AFDB:P77788	0.631	0.678	2.506E-9	135	0.238	0.259	P77788.pdb.gz	NUDG_ECOLI CTP pyrophosphohydrolase OS=Escherichia coli (strain K12) OX=83333 GN=nudG PE=1 SV=1
13	AFDB:A0A1D8PTQ2	0.706	0.133	3.014E-9	907	0.177	0.029	A0A1D8PTQ2.pdb.gz	A0A1D8PTQ2_CANAL Decapping enzyme complex catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCP2 PE=3 SV=1
14	AFDB:P0AFC0	0.703	0.690	3.014E-9	150	0.245	0.240	P0AFC0.pdb.gz	NUDB_ECOLI Dihydroneopterin triphosphate diphosphatase OS=Escherichia coli (strain K12) OX=83333 GN=nudB PE=1 SV=1
15	PDB:2o1cA	0.695	0.695	3.059E-9	147	0.245	0.245	2o1cA.pdb.gz	Structure and function of the E. coli dihydroneopterin triphosphate pyrophosphatase: a Nudix enzyme involved in folate biosynthesis.
16	AFDB:P0A776	0.744	0.633	3.205E-9	176	0.184	0.153	P0A776.pdb.gz	RPPH_ECOLI RNA pyrophosphohydrolase OS=Escherichia coli (strain K12) OX=83333 GN=rppH PE=1 SV=1
17	PDB:2rrkA	0.615	0.640	3.679E-9	140	0.231	0.243	2rrkA.pdb.gz
18	PDB:5gp0I	0.605	0.636	5.855E-8	139	0.177	0.187	5gp0I.pdb.gz	Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis.
19	PDB:7b66A	0.623	0.574	1.385E-7	161	0.197	0.180	7b66A.pdb.gz	Crystal structures of NUDT15 variants enabled by a potent inhibitor reveal the structural basis for thiopurine sensitivity.
20	PDB:4hfqA	0.633	0.476	2.265E-7	203	0.177	0.128	4hfqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50583	1.05e-107	304	147	1.000	1.000	AP4A_HUMAN Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Homo sapiens OX=9606 GN=NUDT2 PE=1 SV=3
2	P56380	2.52e-96	276	147	0.891	0.891	AP4A_MOUSE Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Mus musculus OX=10090 GN=Nudt2 PE=1 SV=3
3	P50584	1.27e-95	274	147	0.884	0.884	AP4A_PIG Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Sus scrofa OX=9823 GN=NUDT2 PE=1 SV=3
4	Q6PEC0	2.82e-95	273	147	0.878	0.878	AP4A_RAT Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Rattus norvegicus OX=10116 GN=Nudt2 PE=2 SV=3
5	Q9U2M7	2.49e-41	136	138	0.476	0.507	AP4A_CAEEL Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Caenorhabditis elegans OX=6239 GN=ndx-4 PE=1 SV=1
6	C0H4F3	1.64e-23	91.7	152	0.354	0.342	C0H4F3_PLAF7 Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0520600 PE=1 SV=1
7	Q6CIU1	7.06e-05	43.9	810	0.204	0.037	Q6CIU1_KLULA KLLA0F23980p OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=KLLA0_F23980g PE=1 SV=1
8	Q75UV1	7.22e-05	42.4	126	0.252	0.294	NDX1_THETH Diadenosine hexaphosphate hydrolase OS=Thermus thermophilus OX=274 GN=ndx1 PE=1 SV=1
9	P0AFC0	3.21e-04	40.8	150	0.238	0.233	NUDB_ECOLI Dihydroneopterin triphosphate diphosphatase OS=Escherichia coli (strain K12) OX=83333 GN=nudB PE=1 SV=1
10	Q52K88	4.46e-04	40.8	202	0.286	0.208	NUD13_ARATH Nudix hydrolase 13, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NUDT13 PE=1 SV=1
11	Q7JVG2	8.21e-04	40.0	177	0.177	0.147	Q7JVG2_DROME diphosphoinositol-polyphosphate diphosphatase OS=Drosophila melanogaster OX=7227 GN=Aps PE=1 SV=1
12	Q9SJC4	0.001	40.0	283	0.231	0.120	NUDT6_ARATH Nudix hydrolase 6 OS=Arabidopsis thaliana OX=3702 GN=NUDT6 PE=1 SV=1
13	P77788	0.002	38.5	135	0.218	0.237	NUDG_ECOLI CTP pyrophosphohydrolase OS=Escherichia coli (strain K12) OX=83333 GN=nudG PE=1 SV=1
14	O95989	0.004	38.1	172	0.197	0.169	NUDT3_HUMAN Diphosphoinositol polyphosphate phosphohydrolase 1 OS=Homo sapiens OX=9606 GN=NUDT3 PE=1 SV=1
15	Q9LE73	0.004	38.1	207	0.279	0.198	NUDT4_ARATH Nudix hydrolase 4 OS=Arabidopsis thaliana OX=3702 GN=NUDT4 PE=1 SV=1
16	P52006	0.005	37.4	141	0.211	0.220	NUDI_ECOLI Nucleoside triphosphatase NudI OS=Escherichia coli (strain K12) OX=83333 GN=nudI PE=1 SV=2
17	Q9SU14	0.007	37.7	282	0.184	0.096	NUDT7_ARATH Nudix hydrolase 7 OS=Arabidopsis thaliana OX=3702 GN=NUDT7 PE=1 SV=1
18	A0A1W2PQS6	0.010	37.4	291	0.231	0.117	A0A1W2PQS6_HUMAN diphosphoinositol-polyphosphate diphosphatase OS=Homo sapiens OX=9606 GN=RPS10-NUDT3 PE=3 SV=1
19	A0A024RBG1	0.012	36.6	181	0.224	0.182	NUD4B_HUMAN Diphosphoinositol polyphosphate phosphohydrolase NUDT4B OS=Homo sapiens OX=9606 GN=NUDT4B PE=3 SV=1
20	P0A776	0.013	36.6	176	0.129	0.108	RPPH_ECOLI RNA pyrophosphohydrolase OS=Escherichia coli (strain K12) OX=83333 GN=rppH PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00293 NUDIX	2.5e-18	77.8	NUDIX domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368455

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000416658	0.925	Nucleoside diphosphate kinase 6
2	9606.ENSP00000219302	0.921	Nucleoside diphosphate kinase 3
3	9606.ENSP00000369456	0.912	Inosine triphosphate pyrophosphatase
4	9606.ENSP00000376886	0.908	Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate (By similarity). Negatively regulates Rho activity by interacting with AKAP13/LBC . Acts as a transcriptional activator of the MYC gene
5	9606.ENSP00000376889	0.908	Nucleoside diphosphate kinase
6	9606.ENSP00000361704	0.907	CTP synthase 1
7	9606.ENSP00000401264	0.907	CTP synthase 2
8	9606.ENSP00000320171	0.905	Pyruvate kinase PKM
9	9606.ENSP00000339933	0.905	Pyruvate kinase PKLR
10	9606.ENSP00000360250	0.904	Ectonucleoside triphosphate diphosphohydrolase 1
11	9606.ENSP00000301825	0.903	Ectonucleoside triphosphate diphosphohydrolase 3
12	9606.ENSP00000360561	0.903	Ectonucleoside triphosphate diphosphohydrolase 8
13	9606.ENSP00000219479	0.902	Nucleoside diphosphate kinase, mitochondrial
14	9606.ENSP00000337060	0.902	Nucleoside diphosphate kinase A
15	9606.ENSP00000356785	0.902	Nucleoside diphosphate kinase 7
16	9606.ENSP00000410186	0.902	Adenylate kinase 9
17	9606.ENSP00000218006	0.901	Retinal guanylyl cyclase 2
18	9606.ENSP00000254854	0.901	Retinal guanylyl cyclase 1
19	9606.ENSP00000261170	0.901	Heat-stable enterotoxin receptor
20	9606.ENSP00000341083	0.901	Atrial natriuretic peptide receptor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016462	1.000	pyrophosphatase activity
GO:0005515	0.985	protein binding
GO:0004081	0.422	bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) activity
GO:0043167	0.377	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0046483	0.995	heterocycle metabolic process
GO:0006139	0.989	nucleobase-containing compound metabolic process
GO:0050896	0.966	response to stimulus
GO:0051716	0.917	cellular response to stimulus
GO:0042221	0.913	response to chemical
GO:0070887	0.886	cellular response to chemical stimulus
GO:0006979	0.838	response to oxidative stress
GO:0033554	0.760	cellular response to stress
GO:0034599	0.686	cellular response to oxidative stress
GO:0044281	0.489	small molecule metabolic process
GO:0009117	0.398	nucleotide metabolic process
GO:1901564	0.343	organonitrogen compound metabolic process
GO:1901135	0.304	carbohydrate derivative metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.997	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0016020	0.410	membrane
GO:0005759	0.345	mitochondrial matrix
GO:0005829	0.300	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	1.000	In phosphorus-containing anhydrides.
RHEA:22484	0.422	H2O + P(1),P(4)-bis(5'-guanosyl) tetraphosphate = GMP + GTP + 2 H(+)
EC:3.6.1.17	0.422	bis(5'-nucleosyl)-tetraphosphatase (asymmetrical).

[back to server]