StarFunc result for job id P50613

User Input

>input (346 residues)
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z3F9	0.892	0.892	3.970E-61	346	1.000	1.000	A0A0S2Z3F9.pdb.gz	A0A0S2Z3F9_HUMAN Cyclin-dependent kinase 7 (Fragment) OS=Homo sapiens OX=9606 GN=CDK7 PE=2 SV=1
2	AFDB:D6RAD4	0.736	0.822	1.293E-45	309	0.893	1.000	D6RAD4.pdb.gz	D6RAD4_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens OX=9606 GN=CDK7 PE=1 SV=1
3	AFDB:Q24216	0.859	0.842	1.193E-44	353	0.639	0.626	Q24216.pdb.gz	Q24216_DROME Cyclin-dependent kinase 7 OS=Drosophila melanogaster OX=7227 GN=Cdk7 PE=1 SV=1
4	AFDB:Q9LMT0	0.843	0.748	3.740E-40	391	0.506	0.448	Q9LMT0.pdb.gz	CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana OX=3702 GN=CDKD-3 PE=1 SV=1
5	AFDB:Q9C9U2	0.855	0.745	3.269E-39	398	0.497	0.432	Q9C9U2.pdb.gz	CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana OX=3702 GN=CDKD-1 PE=1 SV=1
6	AFDB:G5EFV5	0.832	0.871	3.451E-39	330	0.532	0.558	G5EFV5.pdb.gz	CDK7_CAEEL Cyclin-dependent kinase 7 OS=Caenorhabditis elegans OX=6239 GN=cdk-7 PE=1 SV=1
7	AFDB:Q9C9M7	0.845	0.840	5.044E-39	348	0.503	0.500	Q9C9M7.pdb.gz	CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana OX=3702 GN=CDKD-2 PE=1 SV=1
8	PDB:6o9l8	0.777	0.893	1.314E-38	299	0.864	1.000	6o9l8.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
9	AFDB:Q12126	0.807	0.832	4.437E-32	335	0.468	0.484	Q12126.pdb.gz	CRK1_SCHPO Serine/threonine-protein kinase crk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crk1 PE=1 SV=1
10	AFDB:Q00526	0.806	0.911	5.220E-32	305	0.393	0.446	Q00526.pdb.gz	CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens OX=9606 GN=CDK3 PE=1 SV=1
11	AFDB:P29618	0.785	0.919	8.976E-32	294	0.387	0.456	P29618.pdb.gz	CDKA1_ORYSJ Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica OX=39947 GN=CDKA-1 PE=1 SV=1
12	PDB:4gcjA	0.777	0.878	4.740E-29	304	0.384	0.438	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
13	PDB:4ek6A	0.740	0.912	1.607E-27	279	0.353	0.437	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
14	PDB:1unlA	0.733	0.861	9.103E-27	292	0.379	0.449	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
15	PDB:4krcA	0.728	0.841	8.401E-26	297	0.341	0.397	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
16	PDB:4yc3A	0.758	0.884	1.794E-25	295	0.367	0.431	4yc3A.pdb.gz
17	PDB:3mi9A	0.728	0.763	1.898E-23	329	0.364	0.383	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
18	PDB:4eomC	0.671	0.830	7.769E-23	276	0.355	0.446	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
19	PDB:6dtlB	0.694	0.674	3.357E-22	357	0.324	0.314	6dtlB.pdb.gz
20	PDB:7kueA	0.713	0.842	3.357E-22	290	0.402	0.479	7kueA.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z3F9	0.0	716	346	1.000	1.000	A0A0S2Z3F9_HUMAN Cyclin-dependent kinase 7 (Fragment) OS=Homo sapiens OX=9606 GN=CDK7 PE=2 SV=1
2	C9K505	0.0	700	346	0.974	0.974	C9K505_PIG Cyclin-dependent kinase 7 OS=Sus scrofa OX=9823 GN=CDK7 PE=2 SV=1
3	D6R9G1	0.0	528	253	0.731	1.000	D6R9G1_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens OX=9606 GN=CDK7 PE=1 SV=1
4	D6RAD4	0.0	620	309	0.893	1.000	D6RAD4_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens OX=9606 GN=CDK7 PE=1 SV=1
5	P50613	0.0	716	346	1.000	1.000	CDK7_HUMAN Cyclin-dependent kinase 7 OS=Homo sapiens OX=9606 GN=CDK7 PE=1 SV=1
6	P51952	0.0	655	329	0.910	0.957	CDK7_RAT Cyclin-dependent kinase 7 (Fragment) OS=Rattus norvegicus OX=10116 GN=Cdk7 PE=1 SV=2
7	Q03147	0.0	685	346	0.951	0.951	CDK7_MOUSE Cyclin-dependent kinase 7 OS=Mus musculus OX=10090 GN=Cdk7 PE=1 SV=2
8	Q24216	1.37e-170	480	353	0.668	0.654	Q24216_DROME Cyclin-dependent kinase 7 OS=Drosophila melanogaster OX=7227 GN=Cdk7 PE=1 SV=1
9	G5EFV5	4.71e-134	387	330	0.532	0.558	CDK7_CAEEL Cyclin-dependent kinase 7 OS=Caenorhabditis elegans OX=6239 GN=cdk-7 PE=1 SV=1
10	Q9LMT0	2.38e-131	382	391	0.509	0.450	CDKD3_ARATH Cyclin-dependent kinase D-3 OS=Arabidopsis thaliana OX=3702 GN=CDKD-3 PE=1 SV=1
11	Q9C9M7	2.79e-129	375	348	0.506	0.503	CDKD2_ARATH Cyclin-dependent kinase D-2 OS=Arabidopsis thaliana OX=3702 GN=CDKD-2 PE=1 SV=1
12	Q9C9U2	3.85e-126	369	398	0.497	0.432	CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana OX=3702 GN=CDKD-1 PE=1 SV=1
13	Q12126	1.01e-108	322	335	0.468	0.484	CRK1_SCHPO Serine/threonine-protein kinase crk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crk1 PE=1 SV=1
14	Q5AAS1	5.43e-99	298	343	0.439	0.443	Q5AAS1_CANAL [RNA-polymerase]-subunit kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KIN28 PE=3 SV=1
15	P06242	2.21e-96	290	306	0.410	0.464	KIN28_YEAST Serine/threonine-protein kinase KIN28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KIN28 PE=1 SV=1
16	P34112	6.27e-93	281	296	0.402	0.470	CDK1_DICDI Cyclin-dependent kinase 1 OS=Dictyostelium discoideum OX=44689 GN=cdk1 PE=2 SV=1
17	Q00526	2.90e-91	277	305	0.396	0.449	CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens OX=9606 GN=CDK3 PE=1 SV=1
18	P24941	8.45e-90	273	298	0.387	0.450	CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens OX=9606 GN=CDK2 PE=1 SV=2
19	P23437	3.29e-89	271	297	0.376	0.438	CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis OX=8355 GN=cdk2 PE=1 SV=3
20	Q63699	7.10e-89	270	298	0.384	0.446	CDK2_RAT Cyclin-dependent kinase 2 OS=Rattus norvegicus OX=10116 GN=Cdk2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.6	20.7	ABC1 atypical kinase-like domain
2	PF01636 APH	32	15.8	Phosphotransferase enzyme family
3	PF13095 FTA2	7.4e+02	11.2	Kinetochore Sim4 complex subunit FTA2
4	PF12330 Haspin_kinase	85	13.5	Haspin like kinase domain
5	PF14531 Kinase-like	0.089	23.7	Kinase-like
6	PF00069 Pkinase	6e-71	250.5	Protein kinase domain
7	PF17667 Pkinase_fungal	73	13.6	Fungal protein kinase
8	PF07714 PK_Tyr_Ser-Thr	5.7e-29	112.8	Protein tyrosine and serine/threonine kinase
9	PF01163 RIO1	1.7e+02	13.2	RIO1 family
10	PF07387 Seadorna_VP7	0.44	21.2	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000013021

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000005067	0.999	Cyclin H
2	9593.ENSGGOP00000014886	0.999	ERCC excision repair 3, TFIIH core complex helicase subunit
3	9593.ENSGGOP00000017211	0.999	MNAT CDK-activating kinase assembly factor 1
4	9593.ENSGGOP00000017715	0.999	General transcription factor IIH, polypeptide 1, 62kDa
5	9593.ENSGGOP00000002276	0.987	Cyclin-dependent kinase 2
6	9593.ENSGGOP00000015465	0.986	ERCC excision repair 2, TFIIH core complex helicase subunit
7	9593.ENSGGOP00000019128	0.986	General transcription factor IIH, polypeptide 5
8	9593.ENSGGOP00000014450	0.985	DNA-directed RNA polymerase subunit
9	9593.ENSGGOP00000008967	0.982	General transcription factor IIH, polypeptide 3, 34kDa
10	9593.ENSGGOP00000013896	0.980	General transcription factor IIH subunit 4
11	9593.ENSGGOP00000021689	0.967	General transcription factor IIE, polypeptide 1, alpha 56kDa
12	9593.ENSGGOP00000012982	0.963	Cyclin-dependent kinase 1
13	9593.ENSGGOP00000024080	0.954	Transcription initiation factor IIE subunit beta
14	9593.ENSGGOP00000027259	0.935	Transcription elongation factor A (SII), 1
15	9593.ENSGGOP00000020269	0.927	General transcription factor IIB
16	9593.ENSGGOP00000028616	0.927	DNA-directed RNA polymerase subunit beta
17	9593.ENSGGOP00000002134	0.923	Cyclin A2
18	9593.ENSGGOP00000019156	0.917	Polymerase (RNA) II (DNA directed) polypeptide C, 33kDa
19	9593.ENSGGOP00000011550	0.914	TATA box binding protein
20	9593.ENSGGOP00000005108	0.913	Polymerase (RNA) II (DNA directed) polypeptide F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0097472	0.988	cyclin-dependent protein kinase activity
GO:0004693	0.983	cyclin-dependent protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0044237	0.987	cellular metabolic process
GO:0071704	0.982	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0051726	0.980	regulation of cell cycle
GO:0046483	0.978	heterocycle metabolic process
GO:0006725	0.978	cellular aromatic compound metabolic process
GO:0034641	0.977	cellular nitrogen compound metabolic process
GO:0090304	0.966	nucleic acid metabolic process
GO:0006366	0.925	transcription by RNA polymerase II
GO:0080090	0.919	regulation of primary metabolic process
GO:0051171	0.890	regulation of nitrogen compound metabolic process
GO:0060255	0.858	regulation of macromolecule metabolic process
GO:0031323	0.858	regulation of cellular metabolic process
GO:0048518	0.723	positive regulation of biological process
GO:0048522	0.593	positive regulation of cellular process
GO:1901564	0.481	organonitrogen compound metabolic process
GO:0036211	0.422	protein modification process
GO:0009893	0.421	positive regulation of metabolic process
GO:0019219	0.413	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.406	response to stimulus
GO:0051173	0.392	positive regulation of nitrogen compound metabolic process
GO:0031325	0.388	positive regulation of cellular metabolic process
GO:0010468	0.383	regulation of gene expression
GO:0010604	0.362	positive regulation of macromolecule metabolic process
GO:0010564	0.323	regulation of cell cycle process
GO:0009889	0.318	regulation of biosynthetic process
GO:0065009	0.312	regulation of molecular function
GO:0010556	0.309	regulation of macromolecule biosynthetic process
GO:0031326	0.308	regulation of cellular biosynthetic process
GO:0051716	0.304	cellular response to stimulus
GO:0051252	0.300	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0032991	0.997	protein-containing complex
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0140513	0.965	nuclear protein-containing complex
GO:0005829	0.964	cytosol
GO:1902494	0.934	catalytic complex
GO:0140535	0.925	intracellular protein-containing complex
GO:1990234	0.905	transferase complex
GO:0061695	0.889	transferase complex, transferring phosphorus-containing groups
GO:0016020	0.881	membrane
GO:0005667	0.781	transcription regulator complex
GO:0000428	0.766	DNA-directed RNA polymerase complex
GO:0055029	0.763	nuclear DNA-directed RNA polymerase complex
GO:0005886	0.751	plasma membrane
GO:0016591	0.744	RNA polymerase II, holoenzyme
GO:0090575	0.695	RNA polymerase II transcription regulator complex
GO:0005730	0.604	nucleolus
GO:0000307	0.462	cyclin-dependent protein kinase holoenzyme complex
GO:0001650	0.387	fibrillar center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.22	0.983	cyclin-dependent kinase.

[back to server]