StarFunc result for job id P50748

User Input

>input (2209 residues)
MWNDIELLTNDDTGSGYLSVGSRKEHGTALYQVDLLVKISSEKASLNPKIQACSLSDGFI
IVADQSVILLDSICRSLQLHLVFDTEVDVVGLCQEGKFLLVGERSGNLHLIHVTSKQTLL
TNAFVQKANDENRRTYQNLVIEKDGSNEGTYYMLLLTYSGFFCITNLQLLKIQQAIENVD
FSTAKKLQGQIKSSFISTENYHTLGCLSLVAGDLASEVPVIIGGTGNCAFSKWEPDSSKK
GMTVKNLIDAEIIKGAKKFQLIDNLLFVLDTDNVLSLWDIYTLTPVWNWPSLHVEEFLLT
TEADSPSSVTWQGITNLKLIALTASANKKMKNLMVYSLPTMEILYSLEVSSVSSLVQTGI
STDTIYLLEGVCKNDPKLSEDSVSVLVLRCLTEALPENRLSRLLHKHRFAEAESFAIQFG
LDVELVYKVKSNHILEKLALSSVDASEQTEWQQLVDDAKENLHKIQDDEFVVNYCLKAQW
ITYETTQEMLNYAKTRLLKKEDKTALIYSDGLKEVLRAHAKLTTFYGAFGPEKFSGSSWI
EFLNNEDDLKDIFLQLKEGNLVCAQYLWLRHRANFESRFDVKMLESLLNSMSASVSLQKL
CPWFKNDVIPFVRRTVPEGQIILAKWLEQAARNLELTDKANWPENGLQLAEIFFTAEKTD
ELGLASSWHWISLKDYQNTEEVCQLRTLVNNLRELITLHRKYNCKLALSDFEKENTTTIV
FRMFDKVLAPELIPSILEKFIRVYMREHDLQEEELLLLYIEDLLNRCSSKSTSLFETAWE
AKAMAVIACLSDTDLIFDAVLKIMYAAVVPWSAAVEQLVKQHLEMDHPKVKLLQESYKLM
EMKKLLRGYGIREVNLLNKEIMRVVRYILKQDVPSSLEDALKVAQAFMLSDDEIYSLRII
DLIDREQGEDCLLLLKSLPPAEAEKTAERVIIWARLALQEEPDHSKEGKAWRMSVAKTSV
DILKILCDIQKDNLQKKDECEEMLKLFKEVASLQENFEVFLSFEDYSNSSLVADLREQHI
KAHEVAQAKHKPGSTPEPIAAEVRSPSMESKLHRQALALQMSKQELEAELTLRALKDGNI
KTALKKCSDLFKYHCNADTGKLLFLTCQKLCQMLADNVPVTVPVGLNLPSMIHDLASQAA
TICSPDFLLDALELCKHTLMAVELSRQCQMDDCGILMKASFGTHKDPYEEWSYSDFFSED
GIVLESQMVLPVIYELISSLVPLAESKRYPLESTSLPYCSLNEGDGLVLPVINSISALLQ
NLQESSQWELALRFVVGSFGTCLQHSVSNFMNATLSEKLFGETTLVKSRHVVMELKEKAV
IFIRENATTLLHKVFNCRLVDLDLALGYCTLLPQKDVFENLWKLIDKAWQNYDKILAISL
VGSELASLYQEIEMGLKFRELSTDAQWGIRLGKLGISFQPVFRQHFLTKKDLIKALVENI
DMDTSLILEYCSTFQLDCDAVLQLFIETLLHNTNAGQGQGDASMDSAKRRHPKLLAKALE
MVPLLTSTKDLVISLSGILHKLDPYDYEMIEVVLKVIERADEKITNININQALSILKHLK
SYRRISPPVDLEYQYMLEHVITLPSAAQTRLPFHLIFFGTAQNFWKILSTELSEESFPTL
LLISKLMKFSLDTLYVSTAKHVFEKKLKPKLLKLTQAKSSTLINKEITKITQTIESCLLS
IVNPEWAVAIAISLAQDIPEGSFKISALKFCLYLAERWLQNIPSQDEKREKAEALLKKLH
IQYRRSGTEAVLIAHKLNTEEYLRVIGKPAHLIVSLYEHPSINQRIQNSSGTDYPDIHAA
AKEIAEVNEINLEKVWDMLLEKWLCPSTKPGEKPSELFELQEDEALRRVQYLLLSRPIDY
SSRMLFVFATSTTTTLGMHQLTFAHRTRALQCLFYLADKETIESLFKKPIEEVKSYLRCI
TFLASFETLNIPITYELFCSSPKEGMIKGLWKNHSHESMAVRLVTELCLEYKIYDLQLWN
GLLQKLLGFNMIPYLRKVLKAISSIHSLWQVPYFSKAWQRVIQIPLLSASCPLSPDQLSD
CSESLIAVLECPVSGDLDLIGVARQYIQLELPAFALACLMLMPHSEKRHQQIKNFLGSCD
PQVILKQLEEHMNTGQLAGFSHQIRSLILNNIINKKEFGILAKTKYFQMLKMHAMNTNNI
TELVNYLANDLSLDEASVLITEYSKHCGKPVPPDTAPCEILKMFLSGLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7qpgR	0.240	0.240	0.000	2208	1.000	1.000	7qpgR.pdb.gz
2	AFDB:E7ES84	0.285	0.533	0.000	1134	0.511	0.996	E7ES84.pdb.gz	E7ES84_HUMAN Kinetochore associated 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1
3	AFDB:P50748	1.000	1.000	0.000	2209	1.000	1.000	P50748.pdb.gz	KNTC1_HUMAN Kinetochore-associated protein 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1
4	AFDB:Q9V9W7	0.295	0.309	7.179E-57	2089	0.178	0.189	Q9V9W7.pdb.gz	Q9V9W7_DROME Rough deal OS=Drosophila melanogaster OX=7227 GN=rod PE=1 SV=2
5	AFDB:Q20849	0.247	0.263	1.852E-40	2049	0.144	0.156	Q20849.pdb.gz	KNTC1_CAEEL Kinetochore-associated protein rod-1 OS=Caenorhabditis elegans OX=6239 GN=rod-1 PE=1 SV=1
6	AFDB:Q5TYW4	0.208	0.196	1.535E-29	2372	0.158	0.148	Q5TYW4.pdb.gz	NBAS_DANRE NBAS subunit of NRZ tethering complex OS=Danio rerio OX=7955 GN=nbas PE=2 SV=1
7	AFDB:A2RRP1	0.197	0.186	6.596E-29	2371	0.153	0.142	A2RRP1.pdb.gz	NBAS_HUMAN NBAS subunit of NRZ tethering complex OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2
8	AFDB:Q9FIN7	0.213	0.201	8.256E-26	2376	0.145	0.135	Q9FIN7.pdb.gz	MIP2_ARATH MAG2-interacting protein 2 OS=Arabidopsis thaliana OX=3702 GN=MIP2 PE=1 SV=1
9	AFDB:Q5RHH4	0.077	0.093	6.006E-12	1745	0.099	0.125	Q5RHH4.pdb.gz	IF172_DANRE Intraflagellar transport protein 172 homolog OS=Danio rerio OX=7955 GN=ift172 PE=2 SV=1
10	AFDB:Q6VH22	0.079	0.096	6.760E-12	1749	0.100	0.126	Q6VH22.pdb.gz	IF172_MOUSE Intraflagellar transport protein 172 homolog OS=Mus musculus OX=10090 GN=Ift172 PE=1 SV=1
11	AFDB:Q9W040	0.076	0.089	8.563E-12	1754	0.102	0.129	Q9W040.pdb.gz	OSM1_DROME Intraflagellar transport protein 172 homolog OS=Drosophila melanogaster OX=7227 GN=Oseg2 PE=3 SV=3
12	PDB:1xi4A	0.091	0.119	6.444E-10	1630	0.106	0.144	1xi4A.pdb.gz
13	PDB:6qk7A	0.093	0.149	6.589E-9	1161	0.049	0.094	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
14	PDB:7ajtUO	0.113	0.437	7.130E-9	493	0.030	0.136	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mqaLQ	0.058	0.131	3.448E-8	830	0.042	0.112	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:7zu0A	0.086	0.176	3.587E-8	954	0.059	0.137	7zu0A.pdb.gz
17	PDB:7mq8LR	0.100	0.256	3.881E-8	773	0.032	0.092	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7q3eA	0.109	0.371	7.584E-8	551	0.031	0.123	7q3eA.pdb.gz	Structure of the ciliogenesis-associated CPLANE complex.
19	PDB:7d5sB2	0.075	0.162	7.888E-8	851	0.029	0.075	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
20	PDB:7t3rA	0.076	0.077	1.370E-7	2130	0.115	0.120	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1L8I190	0.0	2670	2225	0.597	0.593	A0A1L8I190_XENLA Kinetochore-associated protein 1 isoform X1 OS=Xenopus laevis OX=8355 GN=kntc1.L PE=4 SV=1
2	E7ES84	0.0	1535	1134	0.343	0.668	E7ES84_HUMAN Kinetochore associated 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1
3	P50748	0.0	4536	2209	1.000	1.000	KNTC1_HUMAN Kinetochore-associated protein 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1
4	O96695	6.87e-21	103	2098	0.059	0.062	O96695_DROME Rough deal protein OS=Drosophila melanogaster OX=7227 GN=rod PE=4 SV=1
5	Q9V9W7	1.49e-20	102	2089	0.059	0.062	Q9V9W7_DROME Rough deal OS=Drosophila melanogaster OX=7227 GN=rod PE=1 SV=2
6	Q20849	4.93e-20	100	2049	0.058	0.063	KNTC1_CAEEL Kinetochore-associated protein rod-1 OS=Caenorhabditis elegans OX=6239 GN=rod-1 PE=1 SV=1
7	P37657	1.3	36.6	523	0.012	0.052	BCSE_ECOLI Cyclic di-GMP binding protein BcsE OS=Escherichia coli (strain K12) OX=83333 GN=bcsE PE=1 SV=1
8	Q765P7	3.2	35.4	747	0.009	0.027	MTSS2_HUMAN Protein MTSS 2 OS=Homo sapiens OX=9606 GN=MTSS2 PE=1 SV=1
9	Q96LA5	4.6	34.7	508	0.011	0.047	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
10	Q9W7F8	5.4	34.7	651	0.013	0.043	Q9W7F8_DANRE Forkhead box protein O3 OS=Danio rerio OX=7955 GN=fkhr PE=2 SV=1
11	D4A1W8	6.5	34.3	896	0.028	0.069	MTP_RAT Microsomal triglyceride transfer protein large subunit OS=Rattus norvegicus OX=10116 GN=Mttp PE=1 SV=1
12	Q21952	6.5	34.3	490	0.011	0.049	NUF2_CAEEL Kinetochore protein Nuf2 homolog OS=Caenorhabditis elegans OX=6239 GN=him-10 PE=1 SV=1
13	Q5M729	7.9	33.9	539	0.012	0.050	ODP23_ARATH Dihydrolipoyllysine-residue acetyltransferase component 3 of pyruvate dehydrogenase complex, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g54220 PE=1 SV=1
14	Q557G4	8.2	33.5	332	0.011	0.075	Y3449_DICDI Uncharacterized protein DDB_G0273449/DDB_G0273577 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0273449 PE=2 SV=1
15	Q5CZC0	8.9	34.3	6907	0.016	0.005	FSIP2_HUMAN Fibrous sheath-interacting protein 2 OS=Homo sapiens OX=9606 GN=FSIP2 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10245 MRP-S22	74	14.5	Mitochondrial 28S ribosomal protein S22
2	PF10493 Rod_C	0	1081.7	Rough deal protein C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328236

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000200135	0.999	Centromere/kinetochore protein zw10 homolog
2	9606.ENSP00000311429	0.999	Protein zwilch homolog
3	9606.ENSP00000302530	0.914	Mitotic checkpoint serine/threonine-protein kinase BUB1
4	9606.ENSP00000356379	0.914	Abnormal spindle-like microcephaly-associated protein
5	9606.ENSP00000260731	0.910	Kinesin-like protein KIF11
6	9606.ENSP00000355922	0.894	Centromere protein F
7	9606.ENSP00000287598	0.886	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
8	9606.ENSP00000378699	0.884	Cyclin-dependent kinase 1
9	9606.ENSP00000362146	0.879	Borealin
10	9606.ENSP00000296509	0.873	Mitotic spindle assembly checkpoint protein MAD2A
11	9606.ENSP00000324020	0.871	Kinesin-like protein KIF15
12	9606.ENSP00000240423	0.870	Condensin complex subunit 2
13	9606.ENSP00000265148	0.855	Centromere-associated protein E
14	9606.ENSP00000378295	0.848	Inner centromere protein
15	9606.ENSP00000325017	0.840	Condensin complex subunit 1
16	9606.ENSP00000358813	0.840	Dual specificity protein kinase TTK
17	9606.ENSP00000418960	0.840	Breast cancer type 1 susceptibility protein
18	9606.ENSP00000411532	0.839	DNA topoisomerase 2-alpha
19	9606.ENSP00000256442	0.835	G2/mitotic-specific cyclin-B1
20	9606.ENSP00000323300	0.834	Sperm-associated antigen 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0007049	0.947	cell cycle
GO:0050896	0.938	response to stimulus
GO:0022402	0.937	cell cycle process
GO:1903047	0.877	mitotic cell cycle process
GO:0051716	0.873	cellular response to stimulus
GO:0010564	0.873	regulation of cell cycle process
GO:0051128	0.814	regulation of cellular component organization
GO:0048519	0.800	negative regulation of biological process
GO:1901990	0.762	regulation of mitotic cell cycle phase transition
GO:0033044	0.756	regulation of chromosome organization
GO:0048523	0.755	negative regulation of cellular process
GO:0035556	0.750	intracellular signal transduction
GO:0010948	0.744	negative regulation of cell cycle process
GO:0007088	0.743	regulation of mitotic nuclear division
GO:0051983	0.733	regulation of chromosome segregation
GO:0000075	0.731	cell cycle checkpoint signaling
GO:1901991	0.688	negative regulation of mitotic cell cycle phase transition
GO:1902099	0.676	regulation of metaphase/anaphase transition of cell cycle
GO:0051129	0.675	negative regulation of cellular component organization
GO:0007093	0.675	mitotic cell cycle checkpoint signaling
GO:0030071	0.674	regulation of mitotic metaphase/anaphase transition
GO:0010965	0.672	regulation of mitotic sister chromatid separation
GO:0033047	0.672	regulation of mitotic sister chromatid segregation
GO:2001251	0.669	negative regulation of chromosome organization
GO:0045839	0.667	negative regulation of mitotic nuclear division
GO:1905819	0.666	negative regulation of chromosome separation
GO:1902100	0.666	negative regulation of metaphase/anaphase transition of cell cycle
GO:0007094	0.661	mitotic spindle assembly checkpoint signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0032991	0.999	protein-containing complex
GO:0015629	0.999	actin cytoskeleton
GO:0099080	0.997	supramolecular complex
GO:0098687	0.995	chromosomal region
GO:0000793	0.995	condensed chromosome
GO:0005819	0.995	spindle
GO:0000776	0.989	kinetochore
GO:0099513	0.986	polymeric cytoskeletal fiber
GO:0005876	0.981	spindle microtubule
GO:0000922	0.971	spindle pole
GO:0005828	0.959	kinetochore microtubule
GO:0070013	0.952	intracellular organelle lumen
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0031981	0.942	nuclear lumen
GO:1990423	0.688	RZZ complex
GO:0005654	0.507	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]