StarFunc result for job id P50749

User Input

>input (326 residues)
MDYSHQTSLVPCGQDKYISKNELLLHLKTYNLYYEGQNLQLRHREEEDEFIVEGLLNISW
GLRRPIRLQMQDDNERIRPPPSSSSWHSGCNLGAQGTTLKPLTVPKVQISEVDAPPEGDQ
MPSSTDSRGLKPLQEDTPQLMRTRSDVGVRRRGNVRTPSDQRRIRRHRFSINGHFYNHKT
SVFTPAYGSVTNVRINSTMTTPQVLKLLLNKFKIENSAEEFALYVVHTSGEKQKLKATDY
PLIARILQGPCEQISKVFLMEKDQVEEVTYDVAQYIKFEMPVLKSFIQKLQEEEDREVKK
LMRKYTVLRLMIRQRLEEIAETPATI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P50749	1.000	1.000	4.631E-59	326	1.000	1.000	P50749.pdb.gz	RASF2_HUMAN Ras association domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RASSF2 PE=1 SV=1
2	AFDB:Q9H2L5	0.675	0.685	2.136E-39	321	0.571	0.579	Q9H2L5.pdb.gz	RASF4_HUMAN Ras association domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RASSF4 PE=1 SV=2
3	AFDB:Q6ZTQ3	0.606	0.541	2.923E-32	369	0.393	0.347	Q6ZTQ3.pdb.gz	RASF6_HUMAN Ras association domain-containing protein 6 OS=Homo sapiens OX=9606 GN=RASSF6 PE=1 SV=1
4	AFDB:Q80UQ2	0.632	0.590	5.863E-31	353	0.377	0.348	Q80UQ2.pdb.gz	RASF6_MOUSE Ras association domain-containing protein 6 OS=Mus musculus OX=10090 GN=Rassf6 PE=1 SV=2
5	AFDB:Q9VCQ7	0.400	0.171	2.049E-17	806	0.239	0.097	Q9VCQ7.pdb.gz	Q9VCQ7_DROME LD40758p OS=Drosophila melanogaster OX=7227 GN=Rassf PE=1 SV=3
6	AFDB:Q9VMF3	0.203	0.046	6.742E-4	1573	0.132	0.027	Q9VMF3.pdb.gz	Q9VMF3_DROME Dizzy isoform AII OS=Drosophila melanogaster OX=7227 GN=PDZ-GEF PE=1 SV=2
7	AFDB:P0CE43	0.199	0.111	1.470E-3	599	0.089	0.048	P0CE43.pdb.gz	GRB10_RAT Growth factor receptor-bound protein 10 OS=Rattus norvegicus OX=10116 GN=Grb10 PE=3 SV=1
8	AFDB:Q14449	0.203	0.126	3.206E-3	540	0.083	0.050	Q14449.pdb.gz	GRB14_HUMAN Growth factor receptor-bound protein 14 OS=Homo sapiens OX=9606 GN=GRB14 PE=1 SV=2
9	AFDB:O88900	0.204	0.126	3.404E-3	538	0.098	0.059	O88900.pdb.gz	GRB14_RAT Growth factor receptor-bound protein 14 OS=Rattus norvegicus OX=10116 GN=Grb14 PE=1 SV=1
10	AFDB:P34400	0.209	0.091	3.614E-3	779	0.117	0.049	P34400.pdb.gz	MIG10_CAEEL Abnormal cell migration protein 10 OS=Caenorhabditis elegans OX=6239 GN=mig-10 PE=1 SV=3
11	PDB:4rm8A	0.183	0.164	6.968E-3	368	0.037	0.033	4rm8A.pdb.gz
12	PDB:4f7zA	0.201	0.073	7.399E-3	946	0.046	0.016	4f7zA.pdb.gz
13	PDB:7rbsB	0.177	0.341	1.613E-2	157	0.058	0.121	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
14	PDB:2byvE	0.166	0.062	2.312E-2	922	0.040	0.014	2byvE.pdb.gz
15	PDB:7lq1A	0.182	0.070	3.967E-2	950	0.043	0.015	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:5swpA	0.159	0.056	6.036E-2	1060	0.037	0.011	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
17	PDB:6yvaC	0.171	0.331	6.409E-2	155	0.046	0.097	6yvaC.pdb.gz
18	PDB:4pyuA	0.170	0.621	9.184E-2	76	0.037	0.158	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
19	PDB:7c3mA	0.172	0.103	9.184E-2	577	0.028	0.016	7c3mA.pdb.gz
20	PDB:3dbhI	0.154	0.494	9.752E-2	86	0.021	0.081	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50749	0.0	677	326	1.000	1.000	RASF2_HUMAN Ras association domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RASSF2 PE=1 SV=1
2	Q8BMS9	0.0	612	326	0.926	0.926	RASF2_MOUSE Ras association domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rassf2 PE=1 SV=1
3	Q9H2L5	2.35e-108	320	321	0.577	0.586	RASF4_HUMAN Ras association domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RASSF4 PE=1 SV=2
4	Q6ZTQ3	7.80e-73	231	369	0.411	0.363	RASF6_HUMAN Ras association domain-containing protein 6 OS=Homo sapiens OX=9606 GN=RASSF6 PE=1 SV=1
5	Q80UQ2	1.36e-66	214	341	0.411	0.393	RASF6_MOUSE Ras association domain-containing protein 6 OS=Mus musculus OX=10090 GN=Rassf6 PE=1 SV=2
6	Q9VCQ7	1.52e-37	144	806	0.236	0.096	Q9VCQ7_DROME LD40758p OS=Drosophila melanogaster OX=7227 GN=Rassf PE=1 SV=3
7	Q5EBH1	4.91e-14	74.7	413	0.141	0.111	RASF5_MOUSE Ras association domain-containing protein 5 OS=Mus musculus OX=10090 GN=Rassf5 PE=1 SV=1
8	Q8WWW0	1.06e-12	70.5	418	0.135	0.105	RASF5_HUMAN Ras association domain-containing protein 5 OS=Homo sapiens OX=9606 GN=RASSF5 PE=1 SV=1
9	Q86WH2	3.65e-11	64.3	238	0.123	0.168	RASF3_HUMAN Ras association domain-containing protein 3 OS=Homo sapiens OX=9606 GN=RASSF3 PE=1 SV=1
10	Q5FAQ9	1.70e-09	60.5	340	0.132	0.126	Q5FAQ9_RAT Ras association domain family member 1 OS=Rattus norvegicus OX=10116 GN=Rassf1 PE=4 SV=1
11	Q99MK9	1.81e-09	60.5	340	0.129	0.124	RASF1_MOUSE Ras association domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rassf1 PE=1 SV=1
12	Q9NS23	5.11e-09	58.9	344	0.132	0.125	RASF1_HUMAN Ras association domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RASSF1 PE=1 SV=1
13	E9PFY5	0.002	42.0	250	0.061	0.080	E9PFY5_HUMAN Afadin, adherens junction formation factor (Fragment) OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
14	F8W9I4	0.002	42.0	247	0.061	0.081	F8W9I4_HUMAN Afadin, adherens junction formation factor (Fragment) OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=1
15	A8MQ02	0.003	41.6	1781	0.061	0.011	A8MQ02_HUMAN Afadin, adherens junction formation factor OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=2
16	Q22744	0.003	41.6	615	0.110	0.059	RASF1_CAEEL Ras association domain-containing protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=rsf-1 PE=1 SV=1
17	Q8IPP3	0.025	38.9	1817	0.058	0.010	Q8IPP3_DROME Canoe, isoform D OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=2
18	A0A0B4KF82	0.026	38.9	1818	0.058	0.010	A0A0B4KF82_DROME Canoe, isoform I OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
19	A0A0B4KG43	0.032	38.5	1968	0.058	0.010	A0A0B4KG43_DROME Canoe, isoform H OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1
20	Q8IPP4	0.033	38.5	1882	0.058	0.010	Q8IPP4_DROME Canoe, isoform C OS=Drosophila melanogaster OX=7227 GN=cno PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13526 DUF4125	58	14.8	Protein of unknown function (DUF4125)
2	PF16517 Nore1-SARAH	4.3e-12	56.9	Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
3	PF00788 RA	1.3e-10	53.1	Ras association (RalGDS/AF-6) domain
4	PF14847 Ras_bdg_2	1.1e+02	14.6	Ras-binding domain of Byr2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368710

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429744	0.989	Serine/threonine-protein kinase 3
2	9606.ENSP00000361892	0.959	Serine/threonine-protein kinase 4
3	9606.ENSP00000339692	0.814	Ras association domain-containing protein 4
4	9606.ENSP00000462099	0.738	Ras association domain-containing protein 5
5	9606.ENSP00000306900	0.727	Prion-like protein doppel
6	9606.ENSP00000369291	0.695	LETM1 domain-containing protein LETM2, mitochondrial
7	9606.ENSP00000324729	0.687	Protein salvador homolog 1
8	9606.ENSP00000407586	0.681	GTPase HRas
9	9606.ENSP00000485526	0.679	Ras association domain family member 10
10	9606.ENSP00000380713	0.674	Ras association domain-containing protein 7
11	9606.ENSP00000465517	0.671	UPF0711 protein C18orf21
12	9606.ENSP00000433712	0.668	Shadow of prion protein
13	9606.ENSP00000381053	0.666	Zinc finger MYND domain-containing protein 11
14	9606.ENSP00000381984	0.651	Regulation of nuclear pre-mRNA domain-containing protein 1A
15	9606.ENSP00000481750	0.645	AP-5 complex subunit sigma-1
16	9606.ENSP00000451828	0.643	RAC-alpha serine/threonine-protein kinase
17	9606.ENSP00000368752	0.605	Major prion protein
18	9606.ENSP00000342755	0.596	E3 ubiquitin-protein ligase NRDP1
19	9606.ENSP00000369545	0.589	SOSS complex subunit B1
20	9606.ENSP00000318270	0.584	Prominin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.956	catalytic activity
GO:0140096	0.787	catalytic activity, acting on a protein
GO:0016740	0.779	transferase activity
GO:0004672	0.742	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1902531	0.988	regulation of intracellular signal transduction
GO:0048519	0.982	negative regulation of biological process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0048523	0.972	negative regulation of cellular process
GO:0051246	0.964	regulation of protein metabolic process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0042325	0.940	regulation of phosphorylation
GO:0031399	0.928	regulation of protein modification process
GO:0010604	0.922	positive regulation of macromolecule metabolic process
GO:0009987	0.913	cellular process
GO:0051173	0.898	positive regulation of nitrogen compound metabolic process
GO:0001932	0.880	regulation of protein phosphorylation
GO:0048522	0.876	positive regulation of cellular process
GO:0050896	0.832	response to stimulus
GO:0031325	0.812	positive regulation of cellular metabolic process
GO:0051247	0.811	positive regulation of protein metabolic process
GO:0065009	0.806	regulation of molecular function
GO:0023052	0.790	signaling
GO:0031647	0.781	regulation of protein stability
GO:0080134	0.778	regulation of response to stress
GO:0007154	0.776	cell communication
GO:0007165	0.770	signal transduction
GO:0032501	0.721	multicellular organismal process
GO:0051239	0.721	regulation of multicellular organismal process
GO:0009968	0.718	negative regulation of signal transduction
GO:0043408	0.696	regulation of MAPK cascade
GO:0031401	0.678	positive regulation of protein modification process
GO:0002682	0.671	regulation of immune system process
GO:0045595	0.643	regulation of cell differentiation
GO:1902533	0.636	positive regulation of intracellular signal transduction
GO:0010941	0.585	regulation of cell death
GO:1902105	0.579	regulation of leukocyte differentiation
GO:0080135	0.577	regulation of cellular response to stress
GO:0010605	0.546	negative regulation of macromolecule metabolic process
GO:1902532	0.543	negative regulation of intracellular signal transduction
GO:0050790	0.531	regulation of catalytic activity
GO:0045637	0.516	regulation of myeloid cell differentiation
GO:0042327	0.478	positive regulation of phosphorylation
GO:0043067	0.470	regulation of programmed cell death
GO:0001934	0.470	positive regulation of protein phosphorylation
GO:0042981	0.464	regulation of apoptotic process
GO:0051338	0.459	regulation of transferase activity
GO:0051172	0.444	negative regulation of nitrogen compound metabolic process
GO:0007169	0.443	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0001503	0.437	ossification
GO:0044093	0.434	positive regulation of molecular function
GO:0043549	0.429	regulation of kinase activity
GO:0002761	0.421	regulation of myeloid leukocyte differentiation
GO:0032502	0.418	developmental process
GO:0048856	0.414	anatomical structure development
GO:0031324	0.394	negative regulation of cellular metabolic process
GO:0051248	0.394	negative regulation of protein metabolic process
GO:0043085	0.360	positive regulation of catalytic activity
GO:0010942	0.358	positive regulation of cell death
GO:0033135	0.357	regulation of peptidyl-serine phosphorylation
GO:0007275	0.353	multicellular organism development
GO:0045936	0.347	negative regulation of phosphate metabolic process
GO:0046328	0.333	regulation of JNK cascade
GO:0031400	0.332	negative regulation of protein modification process
GO:0043410	0.319	positive regulation of MAPK cascade
GO:0070304	0.314	positive regulation of stress-activated protein kinase signaling cascade
GO:0031952	0.313	regulation of protein autophosphorylation
GO:0045859	0.308	regulation of protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005829	0.972	cytosol
GO:0031981	0.967	nuclear lumen
GO:0005654	0.964	nucleoplasm
GO:0012505	0.951	endomembrane system
GO:0016020	0.944	membrane
GO:0043232	0.914	intracellular non-membrane-bounded organelle
GO:0071944	0.912	cell periphery
GO:0005886	0.899	plasma membrane
GO:0032991	0.837	protein-containing complex
GO:0005794	0.685	Golgi apparatus
GO:0005694	0.537	chromosome
GO:0098687	0.394	chromosomal region
GO:0099080	0.381	supramolecular complex
GO:0000793	0.353	condensed chromosome
GO:0000775	0.345	chromosome, centromeric region
GO:0000779	0.336	condensed chromosome, centromeric region
GO:0000776	0.333	kinetochore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.779	Transferases.
EC:2.7.1.-	0.742	Phosphotransferases with an alcohol group as acceptor.

[back to server]