StarFunc result for job id P50750

User Input

>input (372 residues)
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFP
ITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVK
FTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNS
QPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLAL
ISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDP
AQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNP
ATTNQTEFERVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7SXE8	0.939	0.934	1.798E-65	374	0.901	0.896	Q7SXE8.pdb.gz	CDK9_DANRE Cyclin-dependent kinase 9 OS=Danio rerio OX=7955 GN=cdk9 PE=2 SV=1
2	PDB:3mi9A	0.842	0.951	2.191E-58	329	0.882	0.997	3mi9A.pdb.gz	Crystal structure of HIV-1 Tat complexed with human P-TEFb.
3	AFDB:O17432	0.914	0.842	7.112E-57	404	0.696	0.641	O17432.pdb.gz	O17432_DROME Cyclin-dependent kinase 9 OS=Drosophila melanogaster OX=7227 GN=Cdk9 PE=1 SV=1
4	AFDB:Q9TVL3	0.881	0.688	1.468E-43	478	0.532	0.414	Q9TVL3.pdb.gz	CDK9_CAEEL Probable cyclin-dependent kinase 9 OS=Caenorhabditis elegans OX=6239 GN=cdk-9 PE=3 SV=2
5	AFDB:Q8W4P1	0.814	0.595	9.041E-39	513	0.449	0.326	Q8W4P1.pdb.gz	CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana OX=3702 GN=CDKC-2 PE=1 SV=2
6	AFDB:Q9NYV4	0.810	0.209	7.870E-37	1490	0.414	0.103	Q9NYV4.pdb.gz	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
7	AFDB:Q9VP22	0.789	0.259	1.173E-35	1157	0.409	0.131	Q9VP22.pdb.gz	CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster OX=7227 GN=Cdk12 PE=1 SV=1
8	AFDB:Q14004	0.786	0.199	2.403E-35	1512	0.414	0.102	Q14004.pdb.gz	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
9	AFDB:P46551	0.787	0.406	2.835E-35	730	0.398	0.203	P46551.pdb.gz	CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans OX=6239 GN=cdk-12 PE=1 SV=4
10	AFDB:Q96VK3	0.815	0.562	3.345E-35	544	0.411	0.281	Q96VK3.pdb.gz	BUR1_EMENI Serine/threonine-protein kinase bur1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ptkA PE=2 SV=1
11	AFDB:A0A2R8YF61	0.784	0.324	1.189E-34	915	0.411	0.167	A0A2R8YF61.pdb.gz	A0A2R8YF61_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
12	PDB:1unlA	0.715	0.900	9.980E-27	292	0.325	0.414	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
13	PDB:4krcA	0.728	0.905	1.114E-26	297	0.309	0.387	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
14	PDB:4eomC	0.657	0.876	4.423E-26	276	0.309	0.417	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
15	PDB:4yc3A	0.681	0.849	9.058E-26	295	0.328	0.414	4yc3A.pdb.gz
16	PDB:7kpvA	0.713	0.741	1.160E-23	357	0.285	0.297	7kpvA.pdb.gz
17	PDB:4gcjA	0.688	0.834	1.905E-23	304	0.328	0.401	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
18	PDB:1blxA	0.639	0.767	5.740E-23	305	0.304	0.370	1blxA.pdb.gz	Crystal structure of the complex of the cyclin D-dependent kinase Cdk6 bound to the cell-cycle inhibitor p19INK4d.
19	PDB:7cgaA	0.679	0.726	9.428E-23	347	0.274	0.294	7cgaA.pdb.gz
20	PDB:4ek6A	0.647	0.851	1.931E-22	279	0.296	0.394	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O17432	0.0	536	404	0.710	0.653	O17432_DROME Cyclin-dependent kinase 9 OS=Drosophila melanogaster OX=7227 GN=Cdk9 PE=1 SV=1
2	P50750	0.0	779	372	1.000	1.000	CDK9_HUMAN Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3
3	Q641Z4	0.0	771	372	0.987	0.987	CDK9_RAT Cyclin-dependent kinase 9 OS=Rattus norvegicus OX=10116 GN=Cdk9 PE=2 SV=1
4	Q7SXE8	0.0	692	374	0.903	0.898	CDK9_DANRE Cyclin-dependent kinase 9 OS=Danio rerio OX=7955 GN=cdk9 PE=2 SV=1
5	Q99J95	0.0	771	372	0.987	0.987	CDK9_MOUSE Cyclin-dependent kinase 9 OS=Mus musculus OX=10090 GN=Cdk9 PE=1 SV=1
6	Q9TVL3	3.80e-128	378	478	0.546	0.425	CDK9_CAEEL Probable cyclin-dependent kinase 9 OS=Caenorhabditis elegans OX=6239 GN=cdk-9 PE=3 SV=2
7	Q9LFT8	7.62e-105	319	505	0.430	0.317	CDKC1_ARATH Cyclin-dependent kinase C-1 OS=Arabidopsis thaliana OX=3702 GN=CDKC-1 PE=1 SV=1
8	Q8W4P1	1.10e-103	317	513	0.430	0.312	CDKC2_ARATH Cyclin-dependent kinase C-2 OS=Arabidopsis thaliana OX=3702 GN=CDKC-2 PE=1 SV=2
9	J3QSD7	6.83e-91	298	1201	0.395	0.122	J3QSD7_HUMAN Cyclin dependent kinase 12 (Fragment) OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=1
10	A0A2R8Y7W5	1.00e-90	296	1099	0.398	0.135	A0A2R8Y7W5_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
11	Q3MJK5	1.47e-90	299	1484	0.438	0.110	CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus OX=10116 GN=Cdk12 PE=1 SV=1
12	Q14AX6	4.32e-90	298	1484	0.395	0.099	CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus OX=10090 GN=Cdk12 PE=1 SV=2
13	Q9NYV4	4.35e-90	298	1490	0.395	0.099	CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2
14	A0A2R8Y4Z0	6.00e-90	296	1308	0.398	0.113	A0A2R8Y4Z0_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1
15	Q14004	1.74e-89	296	1512	0.398	0.098	CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=2
16	Q69ZA1	2.09e-89	296	1511	0.398	0.098	CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus OX=10090 GN=Cdk13 PE=1 SV=3
17	Q96VK3	2.06e-87	276	544	0.398	0.272	BUR1_EMENI Serine/threonine-protein kinase bur1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ptkA PE=2 SV=1
18	Q96WV9	6.85e-87	276	591	0.390	0.245	CDK9_SCHPO Probable cyclin-dependent kinase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdk9 PE=1 SV=1
19	P46551	3.81e-86	277	730	0.371	0.189	CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans OX=6239 GN=cdk-12 PE=1 SV=4
20	A0A2R8YF61	1.16e-85	280	915	0.395	0.161	A0A2R8YF61_HUMAN Cyclin dependent kinase 13 (Fragment) OS=Homo sapiens OX=9606 GN=CDK13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.044	24.5	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	0.63	20.6	Haspin like kinase domain
3	PF14531 Kinase-like	2.9	18.7	Kinase-like
4	PF00069 Pkinase	2.1e-66	235.6	Protein kinase domain
5	PF17667 Pkinase_fungal	1.8e+02	12.3	Fungal protein kinase
6	PF07714 PK_Tyr_Ser-Thr	5e-29	112.9	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000009958

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000002550	0.999	Cyclin T1
2	60711.ENSCSAP00000012477	0.997	Cyclin T2
3	60711.ENSCSAP00000007724	0.991	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
4	60711.ENSCSAP00000009840	0.989	AF4/FMR2 family, member 4
5	60711.ENSCSAP00000018531	0.987	Hexamethylene bis-acetamide inducible 1
6	60711.ENSCSAP00000002413	0.973	Bromodomain containing 4
7	60711.ENSCSAP00000005946	0.963	MLLT1, super elongation complex subunit
8	60711.ENSCSAP00000006688	0.963	Cyclin K
9	60711.ENSCSAP00000000189	0.958	Transcription elongation factor SPT5
10	60711.ENSCSAP00000013915	0.958	Methylphosphate capping enzyme
11	60711.ENSCSAP00000010896	0.955	Cyclin H
12	60711.ENSCSAP00000000677	0.946	AF4/FMR2 family, member 1
13	60711.ENSCSAP00000006343	0.946	MYC proto-oncogene, bHLH transcription factor
14	60711.ENSCSAP00000005730	0.939	MLLT3, super elongation complex subunit
15	60711.ENSCSAP00000003474	0.923	AF4/FMR2 family, member 2
16	60711.ENSCSAP00000010743	0.897	Cyclin C
17	60711.ENSCSAP00000010502	0.891	Uncharacterized protein
18	60711.ENSCSAP00000004856	0.884	UBX domain protein 7
19	60711.ENSCSAP00000000047	0.881	Hexamethylene bis-acetamide inducible 2
20	60711.ENSCSAP00000013762	0.878	RB transcriptional corepressor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004674	0.999	protein serine/threonine kinase activity
GO:0008353	0.993	RNA polymerase II CTD heptapeptide repeat kinase activity
GO:0003682	0.789	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0009987	0.974	cellular process
GO:0051252	0.956	regulation of RNA metabolic process
GO:0008152	0.894	metabolic process
GO:0044237	0.876	cellular metabolic process
GO:0010468	0.873	regulation of gene expression
GO:0048518	0.863	positive regulation of biological process
GO:0010556	0.774	regulation of macromolecule biosynthetic process
GO:0031326	0.774	regulation of cellular biosynthetic process
GO:0006355	0.760	regulation of DNA-templated transcription
GO:0048522	0.743	positive regulation of cellular process
GO:0050896	0.708	response to stimulus
GO:0071704	0.661	organic substance metabolic process
GO:0044238	0.661	primary metabolic process
GO:0006807	0.633	nitrogen compound metabolic process
GO:0043170	0.591	macromolecule metabolic process
GO:0006351	0.529	DNA-templated transcription
GO:0006950	0.425	response to stress
GO:0048583	0.381	regulation of response to stimulus
GO:0006366	0.363	transcription by RNA polymerase II
GO:0048519	0.351	negative regulation of biological process
GO:0006357	0.326	regulation of transcription by RNA polymerase II
GO:0010604	0.318	positive regulation of macromolecule metabolic process
GO:0044260	0.301	cellular macromolecule metabolic process
GO:0065009	0.300	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005654	0.987	nucleoplasm
GO:0032991	0.985	protein-containing complex
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:1990234	0.940	transferase complex
GO:0061695	0.879	transferase complex, transferring phosphorus-containing groups
GO:0099080	0.810	supramolecular complex
GO:0005737	0.794	cytoplasm
GO:0008023	0.765	transcription elongation factor complex
GO:0035770	0.743	ribonucleoprotein granule
GO:0036464	0.647	cytoplasmic ribonucleoprotein granule
GO:0000307	0.581	cyclin-dependent protein kinase holoenzyme complex
GO:0032806	0.405	carboxy-terminal domain protein kinase complex
GO:0019908	0.391	nuclear cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.
RHEA:10216	0.993	[DNA-directed RNA polymerase] + ATP = ADP + H(+) + phospho-[DNA-directed RNA polymerase]
EC:2.7.11.23	0.993	[RNA-polymerase]-subunit kinase.

[back to server]