StarFunc result for job id P50851

User Input

>input (1400 residues)
MASEDNRVPSPPPTGDDGGGGGREETPTEGGALSLKPGLPIRGIRMKFAVLTGLVEVGEV
SNRDIVETVFNLLVGGQFDLEMNFIIQEGESINCMVDLLEKCDITCQAEVWSMFTAILKK
SIRNLQVCTEVGLVEKVLGKIEKVDNMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDK
GRWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMD
PVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIVTSIKSKGKGFQHCVKFDFKPQKWY
MVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQ
MTAVYLFSEALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFT
YNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLF
AQLDYRQYLSDEIDLTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSSKSHV
SRAVLELCLAFSKYLSNLQNGMPLLKQLCDHVLLNPAIWIHTPAKVQLMLYTYLSTEFIG
TVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPNQKEMLSLRAFLLM
FIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNG
LRVIYKLLASKSEGIRVQALKAMGYFLKHLAPKRKAEVMLGHGLFSLLAERLMLQTNLIT
MTTYNVLFEILIEQIGTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCPESMEVRR
AFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYH
AVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREQQGKVDEEIGLCSSTSVQAASG
IRRDINVSVGSQQPDTKDSPVCPHFTTNGNENSSIEKTSSLESASNIELQTTNTSYEEMK
AEQENQELPDEGTLEETLTNETRNADDLEVSSDIIEAVAISSNSFITTGKDSMTVSEVTA
SISSPSEEDASEMPEFLDKSIVEEEEDDDYVELKVEGSPTEEANLPTELQDNSLSPAASE
AGEKLDMFGNDDKLIFQEGKPVTEKQTDTETQDSKDSGIQTMTASGSSAMSPETTVSQIA
VESDLGQMLEEGKKATNLTRETKLINDCHGSVSEASSEQKIAKLDVSNVATDTERLELKA
SPNVEAPQPHRHVLEISRQHEQPGQGIAPDAVNGQRRDSRSTVFRIPEFNWSQMHQRLLT
DLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLS
AATSATHELENIEPTQGLSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q19317	0.630	0.355	4.573E-80	2507	0.278	0.155	Q19317.pdb.gz	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
2	AFDB:E9QCE1	0.390	0.894	4.009E-70	607	0.308	0.710	E9QCE1.pdb.gz
3	AFDB:Q6PR54	0.194	0.129	5.346E-8	2419	0.111	0.064	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
4	PDB:7zl1A	0.105	0.608	4.828E-7	215	0.019	0.126	7zl1A.pdb.gz
5	AFDB:A0A0G2JZW4	0.138	0.094	1.327E-6	2308	0.092	0.056	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
6	AFDB:E1C2U2	0.228	0.153	2.175E-6	2326	0.115	0.069	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
7	AFDB:Q5UIP0	0.199	0.130	3.024E-6	2472	0.114	0.064	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
8	PDB:3v0aB	0.101	0.121	7.017E-6	1150	0.039	0.048	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
9	PDB:5n0cA	0.104	0.112	7.312E-6	1293	0.054	0.058	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
10	PDB:4pbpB	0.111	0.650	7.619E-6	210	0.021	0.138	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
11	PDB:2a3wA	0.107	0.655	7.940E-6	204	0.021	0.147	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
12	PDB:7qfqA	0.100	0.108	1.016E-5	1291	0.043	0.046	7qfqA.pdb.gz
13	PDB:3ffzA	0.098	0.109	1.150E-5	1246	0.034	0.039	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
14	PDB:1b09A	0.103	0.614	1.666E-5	206	0.016	0.107	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
15	PDB:7ufgB	0.103	0.121	3.090E-5	1182	0.017	0.020	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
16	AFDB:F4J8G7	0.120	0.089	3.728E-5	2138	0.126	0.083	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
17	AFDB:X1WE68	0.096	0.073	4.772E-5	2527	0.112	0.062	X1WE68.pdb.gz
18	PDB:7ufgA	0.113	0.136	5.499E-5	1151	0.024	0.030	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
19	AFDB:Q8WYP5	0.092	0.074	4.788E-4	2266	0.124	0.077	Q8WYP5.pdb.gz	ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3
20	AFDB:Q9VW47	0.122	0.082	2.197E-3	2531	0.076	0.042	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P50851	0.0	2916	2863	1.000	0.489	LRBA_HUMAN Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4
2	Q19317	0.0	772	2507	0.274	0.153	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
3	Q9EPN1	0.0	1642	2936	0.614	0.293	NBEA_MOUSE Neurobeachin OS=Mus musculus OX=10090 GN=Nbea PE=1 SV=1
4	Q9ESE1	0.0	2497	2856	0.880	0.431	LRBA_MOUSE Lipopolysaccharide-responsive and beige-like anchor protein OS=Mus musculus OX=10090 GN=Lrba PE=1 SV=1
5	Q9W4E2	0.0	649	3466	0.226	0.091	NBEA_DROME Neurobeachin OS=Drosophila melanogaster OX=7227 GN=rg PE=1 SV=4
6	F4I9T0	7.82e-48	191	2604	0.152	0.082	BCHB_ARATH BEACH domain-containing protein B OS=Arabidopsis thaliana OX=3702 GN=BCHB PE=4 SV=1
7	E7EZD1	2.37e-39	163	2998	0.054	0.025	E7EZD1_DANRE Neurobeachin OS=Danio rerio OX=7955 GN=im:7138260 PE=1 SV=2
8	Q54RQ8	2.94e-34	146	2192	0.092	0.059	LVSE_DICDI BEACH domain-containing protein lvsE OS=Dictyostelium discoideum OX=44689 GN=lvsE PE=4 SV=1
9	F4JD14	8.72e-16	85.9	1941	0.094	0.068	BCHC1_ARATH BEACH domain-containing protein C1 OS=Arabidopsis thaliana OX=3702 GN=BCHC1 PE=1 SV=1
10	Q6ZNJ1	9.24e-13	76.3	2754	0.037	0.019	NBEL2_HUMAN Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2 PE=1 SV=2
11	Q6ZQA0	3.21e-12	74.3	2742	0.039	0.020	NBEL2_MOUSE Neurobeachin-like protein 2 OS=Mus musculus OX=10090 GN=Nbeal2 PE=1 SV=2
12	E7FAW3	7.54e-12	73.2	2801	0.056	0.028	NBEL2_DANRE Neurobeachin-like protein 2 OS=Danio rerio OX=7955 GN=nbeal2 PE=1 SV=1
13	Q55DM1	8.56e-06	53.1	3619	0.056	0.022	LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum OX=44689 GN=lvsA PE=4 SV=2
14	Q55AV3	0.016	42.4	2967	0.036	0.017	LVSD_DICDI BEACH domain-containing protein lvsD OS=Dictyostelium discoideum OX=44689 GN=lvsD PE=4 SV=2
15	F4HZB2	0.19	38.9	3601	0.017	0.007	BCHA1_ARATH Protein SPIRRIG OS=Arabidopsis thaliana OX=3702 GN=SPI PE=1 SV=1
16	P20448	0.39	37.7	770	0.021	0.039	DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HCA4 PE=1 SV=2
17	Q6FKF2	0.68	36.2	250	0.018	0.100	Q6FKF2_CANGA Candida glabrata strain CBS138 chromosome L complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=BMH1(A) PE=3 SV=1
18	P35213	5.3	33.1	246	0.016	0.093	1433B_RAT 14-3-3 protein beta/alpha OS=Rattus norvegicus OX=10116 GN=Ywhab PE=1 SV=3
19	Q9CQV8	5.6	33.1	246	0.016	0.093	1433B_MOUSE 14-3-3 protein beta/alpha OS=Mus musculus OX=10090 GN=Ywhab PE=1 SV=3
20	P31946	6.8	33.1	246	0.016	0.093	1433B_HUMAN 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15787 DUF4704	2.6e-172	585.7	Neurobeachin/BDCP, DUF4704 alpha solenoid region
2	PF13385 Laminin_G_3	6.7e-09	47.5	Concanavalin A-like lectin/glucanases superfamily
3	PF20425 Neurobeachin	2.3e-06	38.5	Neurobeachin alpha solenoid region
4	PF10363 RTP1_C1	7.3e+02	11.7	Required for nuclear transport of RNA pol II C-terminus 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000463151	0.764	Retinol-binding protein 3
2	9606.ENSP00000413606	0.753	Syntaxin-binding protein 2
3	9606.ENSP00000303939	0.727	Cytotoxic T-lymphocyte protein 4
4	9606.ENSP00000349205	0.726	Phosphoinositide 3-kinase regulatory subunit 4
5	9606.ENSP00000207549	0.724	Protein unc-13 homolog D
6	9606.ENSP00000306627	0.697	Sodium/hydrogen exchanger 10
7	9606.ENSP00000296695	0.695	Serine protease inhibitor Kazal-type 1
8	9606.ENSP00000261172	0.656	Epiphycan
9	9606.ENSP00000379210	0.649	Myosin light chain 3
10	9606.ENSP00000281708	0.643	F-box/WD repeat-containing protein 7
11	9606.ENSP00000430955	0.642	E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. In response to bacterial infection, negatively regulates the phagocyte oxidative burst by controlling the turnover of the NADPH oxidase complex subunits. Promotes monoubiquitination of CYBA and 'Lys-48'- linked polyubiquitination and degradation of CYBB NADPH oxidase catalytic subunits, both essential for the generation of antimicrobial reactive oxygen species. Involved in the maintenance of cholesterol homeostasis. In response to high sterol concentrations [...]
12	9606.ENSP00000265717	0.633	cAMP-dependent protein kinase type II-beta regulatory subunit
13	9606.ENSP00000361704	0.633	CTP synthase 1
14	9606.ENSP00000355955	0.629	Neudesin
15	9606.ENSP00000356825	0.629	Adenylate cyclase type 10
16	9606.ENSP00000380150	0.629	Caspase recruitment domain-containing protein 11
17	9606.ENSP00000395538	0.614	Trinucleotide repeat-containing gene 18 protein
18	9606.ENSP00000356953	0.611	Succinate dehydrogenase cytochrome b560 subunit, mitochondrial
19	9606.ENSP00000413196	0.611	Protein FAM160A1
20	9606.ENSP00000351740	0.607	Protein NOXP20

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.467	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.958	cellular process
GO:0050794	0.917	regulation of cellular process
GO:0051641	0.827	cellular localization
GO:0050896	0.787	response to stimulus
GO:0044237	0.785	cellular metabolic process
GO:0051716	0.761	cellular response to stimulus
GO:0061919	0.678	process utilizing autophagic mechanism
GO:0044248	0.610	cellular catabolic process
GO:0006996	0.606	organelle organization
GO:0022411	0.583	cellular component disassembly
GO:0016236	0.583	macroautophagy
GO:0010033	0.576	response to organic substance
GO:0007154	0.573	cell communication
GO:0034097	0.527	response to cytokine
GO:0061726	0.513	mitochondrion disassembly
GO:0008104	0.490	protein localization
GO:0044085	0.455	cellular component biogenesis
GO:0022607	0.448	cellular component assembly
GO:0061912	0.419	selective autophagy
GO:0046907	0.349	intracellular transport
GO:0016192	0.342	vesicle-mediated transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005622	0.951	intracellular anatomical structure
GO:0005737	0.862	cytoplasm
GO:0012505	0.861	endomembrane system
GO:0005886	0.822	plasma membrane
GO:0043227	0.774	membrane-bounded organelle
GO:0043231	0.761	intracellular membrane-bounded organelle
GO:0005794	0.424	Golgi apparatus
GO:0048471	0.363	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]