StarFunc result for job id P50993

User Input

>input (1020 residues)
MGRGAGREYSPAATTAENGGGKKKQKEKELDELKKEVAMDDHKLSLDELGRKYQVDLSKG
LTNQRAQDVLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAME
DEPSNDNLYLGVVLAAVVIVTGCFSYYQEAKSSKIMDSFKNMVPQQALVIREGEKMQINA
EEVVVGDLVEVKGGDRVPADLRIISSHGCKVDNSSLTGESEPQTRSPEFTHENPLETRNI
CFFSTNCVEGTARGIVIATGDRTVMGRIATLASGLEVGRTPIAMEIEHFIQLITGVAVFL
GVSFFVLSLILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGATFDKRSPTWTALS
RIAGLCNRAVFKAGQENISVSKRDTAGDASESALLKCIELSCGSVRKMRDRNPKVAEIPF
NSTNKYQLSIHEREDSPQSHVLVMKGAPERILDRCSTILVQGKEIPLDKEMQDAFQNAYM
ELGGLGERVLGFCQLNLPSGKFPRGFKFDTDELNFPTEKLCFVGLMSMIDPPRAAVPDAV
GKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPMSQVNPREAKAC
VVHGSDLKDMTSEQLDEILKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSP
ALKKADIGIAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSN
IPEITPFLLFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEAAESDIMKRQPRNSQTDK
LVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPSRLLGIRLDWDDRTMNDLEDSYG
QEWTYEQRKVVEFTCHTAFFASIVVVQWADLIICKTRRNSVFQQGMKNKILIFGLLEETA
LAAFLSYCPGMGVALRMYPLKVTWWFCAFPYSLLIFIYDEVRKLILRRYPGGWVEKETYY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3b8eA	0.946	0.967	0.000	998	0.855	0.874	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
2	PDB:8d3xA	0.954	0.984	0.000	989	0.859	0.886	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
3	AFDB:A2VDL6	0.995	0.995	0.000	1020	0.990	0.990	A2VDL6.pdb.gz	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
4	AFDB:A8QI34	0.972	0.983	0.000	1009	0.619	0.625	A8QI34.pdb.gz	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
5	AFDB:B0S5Q5	0.986	0.989	0.000	1017	0.861	0.863	B0S5Q5.pdb.gz
6	AFDB:B8JKS9	0.980	0.978	0.000	1023	0.775	0.772	B8JKS9.pdb.gz
7	AFDB:C0H8U1	0.970	0.963	0.000	1028	0.832	0.826	C0H8U1.pdb.gz	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
8	AFDB:E1B8N5	0.972	0.962	0.000	1030	0.808	0.800	E1B8N5.pdb.gz	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
9	AFDB:P13607	0.966	0.947	0.000	1041	0.751	0.736	P13607.pdb.gz	ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=Atpalpha PE=1 SV=3
10	AFDB:P20648	0.984	0.970	0.000	1035	0.628	0.619	P20648.pdb.gz	ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens OX=9606 GN=ATP4A PE=1 SV=5
11	AFDB:P54707	0.976	0.958	0.000	1039	0.646	0.634	P54707.pdb.gz	AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens OX=9606 GN=ATP12A PE=1 SV=3
12	AFDB:P54708	0.980	0.965	0.000	1036	0.644	0.634	P54708.pdb.gz	AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus OX=10116 GN=Atp12a PE=1 SV=1
13	PDB:7x20A	0.943	0.975	3.483E-104	986	0.634	0.656	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
14	PDB:3ixzA	0.936	0.957	4.125E-96	998	0.619	0.632	3ixzA.pdb.gz
15	PDB:7e7sA	0.588	0.588	1.029E-54	1020	0.273	0.273	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
16	PDB:5zmwA	0.573	0.583	2.720E-52	1000	0.277	0.283	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
17	PDB:6a69A	0.532	0.582	5.359E-38	911	0.232	0.260	6a69A.pdb.gz
18	PDB:7vpkA	0.703	0.682	2.208E-34	1055	0.183	0.177	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7vh5A	0.490	0.601	1.826E-33	804	0.193	0.245	7vh5A.pdb.gz
20	PDB:7m5xA	0.655	0.667	4.162E-32	1000	0.177	0.181	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060D574	1585	875	0.754	0.879	A0A060D574_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1c PE=2 SV=1
2	A0A060D9G1	1468	876	0.680	0.792	A0A060D9G1_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=NAKa1a PE=2 SV=1
3	A0A060XA63	951	517	0.440	0.868	A0A060XA63_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00000245001 PE=3 SV=1
4	A0A060YJC3	1803	992	0.847	0.871	A0A060YJC3_ONCMY Sodium/potassium-transporting ATPase subunit alpha OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025817001 PE=3 SV=1
5	A0A060YK73	957	534	0.446	0.852	A0A060YK73_ONCMY Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00025818001 PE=3 SV=1
6	A0A075Q735	1022	639	0.504	0.804	A0A075Q735_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
7	A0A075QE41	1061	661	0.523	0.806	A0A075QE41_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=ATP1A1 PE=2 SV=1
8	A2VDL6	2096	1020	0.990	0.990	AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus OX=9913 GN=ATP1A2 PE=1 SV=1
9	A8QI34	1315	1009	0.619	0.625	A8QI34_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster OX=7227 GN=JYalpha PE=3 SV=2
10	C0H8U1	1731	1028	0.833	0.827	C0H8U1_SALSA Sodium/potassium-transporting ATPase subunit alpha OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
11	C0PUF8	995	524	0.461	0.897	C0PUF8_SALSA Sodium/potassium-transporting ATPase subunit alpha (Fragment) OS=Salmo salar OX=8030 GN=AT1A1 PE=2 SV=1
12	E1B8N5	1709	1030	0.796	0.788	E1B8N5_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A4 PE=3 SV=2
13	F1MR06	1745	988	0.827	0.854	F1MR06_BOVIN Sodium/potassium-transporting ATPase subunit alpha OS=Bos taurus OX=9913 GN=ATP1A3 PE=3 SV=3
14	P05023	1847	1023	0.870	0.867	AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1 PE=1 SV=1
15	P05024	1850	1021	0.869	0.868	AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa OX=9823 GN=ATP1A1 PE=1 SV=1
16	P06685	1830	1023	0.866	0.863	AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Atp1a1 PE=1 SV=1
17	P06686	2096	1020	0.991	0.991	AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Atp1a2 PE=1 SV=1
18	P06687	1848	1013	0.863	0.869	AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Atp1a3 PE=1 SV=2
19	P09572	1826	1021	0.869	0.868	AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus OX=9031 GN=ATP1A1 PE=2 SV=1
20	P09626	1357	1033	0.625	0.617	ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus OX=10116 GN=Atp4a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	2e-19	80.7	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	3.8e-40	149.0	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	3.6e-13	60.3	Cation transporter/ATPase, N-terminus
4	PF00122 E1-E2_ATPase	5.1e-42	155.0	E1-E2 ATPase
5	PF12710 HAD	3.3e+02	13.2	haloacid dehalogenase-like hydrolase
6	PF00702 Hydrolase	2.9e-15	68.7	haloacid dehalogenase-like hydrolase
7	PF08282 Hydrolase_3	0.077	24.3	haloacid dehalogenase-like hydrolase
8	PF04545 Sigma70_r4	1.3e+02	13.5	Sigma-70, region 4

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354490

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356790	0.987	Sodium/potassium-transporting ATPase subunit beta-1
2	9606.ENSP00000250111	0.971	Sodium/potassium-transporting ATPase subunit beta-2
3	9606.ENSP00000292079	0.965	Sodium/potassium-transporting ATPase subunit gamma
4	9606.ENSP00000218008	0.936	Protein ATP1B4
5	9606.ENSP00000286371	0.933	Sodium/potassium-transporting ATPase subunit beta-3
6	9606.ENSP00000481244	0.906	Phospholemman
7	9606.ENSP00000353362	0.889	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
8	9606.ENSP00000445306	0.877	Sodium/potassium-transporting ATPase subunit alpha-1
9	9606.ENSP00000303540	0.862	Sodium channel protein type 1 subunit alpha
10	9606.ENSP00000444688	0.827	Sodium/potassium-transporting ATPase subunit alpha-3
11	9606.ENSP00000369320	0.822	Retinoschisin
12	9606.ENSP00000350132	0.816	Cardiac phospholamban
13	9606.ENSP00000357060	0.804	Sodium/potassium-transporting ATPase subunit alpha-4
14	9606.ENSP00000440045	0.801	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
15	9606.ENSP00000263980	0.768	Sodium/hydrogen exchanger 1
16	9606.ENSP00000334216	0.757	Potassium-transporting ATPase subunit beta
17	9606.ENSP00000482442	0.756	FXYD domain containing ion transport regulator 6
18	9606.ENSP00000344155	0.743	ATP-binding cassette sub-family A member 2
19	9606.ENSP00000349396	0.741	ATP-binding cassette sub-family D member 4
20	9606.ENSP00000272286	0.740	ATP-binding cassette sub-family G member 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0005391	0.998	P-type sodium:potassium-exchanging transporter activity
GO:0043167	0.456	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.977	multicellular organismal process
GO:0050896	0.960	response to stimulus
GO:0009987	0.923	cellular process
GO:0065007	0.910	biological regulation
GO:0006810	0.895	transport
GO:0050789	0.892	regulation of biological process
GO:0042221	0.883	response to chemical
GO:0003015	0.864	heart process
GO:0008015	0.831	blood circulation
GO:0009719	0.815	response to endogenous stimulus
GO:1901700	0.803	response to oxygen-containing compound
GO:0010033	0.785	response to organic substance
GO:0048856	0.775	anatomical structure development
GO:0007275	0.746	multicellular organism development
GO:0048878	0.721	chemical homeostasis
GO:0048731	0.689	system development
GO:0050794	0.670	regulation of cellular process
GO:0007399	0.642	nervous system development
GO:0065008	0.605	regulation of biological quality
GO:0006950	0.581	response to stress
GO:0060416	0.564	response to growth hormone
GO:0007420	0.534	brain development
GO:0007610	0.533	behavior
GO:0042538	0.529	hyperosmotic salinity response
GO:0014070	0.500	response to organic cyclic compound
GO:0006811	0.499	monoatomic ion transport
GO:0055085	0.497	transmembrane transport
GO:0007154	0.446	cell communication
GO:0051716	0.442	cellular response to stimulus
GO:0030001	0.440	metal ion transport
GO:0044057	0.427	regulation of system process
GO:0034220	0.417	monoatomic ion transmembrane transport
GO:0050801	0.408	monoatomic ion homeostasis
GO:0098660	0.378	inorganic ion transmembrane transport
GO:0098771	0.376	inorganic ion homeostasis
GO:0055080	0.374	monoatomic cation homeostasis
GO:0098662	0.370	inorganic cation transmembrane transport
GO:0098655	0.368	monoatomic cation transmembrane transport
GO:0023052	0.346	signaling
GO:0098657	0.335	import into cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.960	membrane-bounded organelle
GO:0032991	0.936	protein-containing complex
GO:1902495	0.934	transmembrane transporter complex
GO:0098797	0.924	plasma membrane protein complex
GO:0005622	0.912	intracellular anatomical structure
GO:0098533	0.910	ATPase dependent transmembrane transport complex
GO:0090533	0.891	cation-transporting ATPase complex
GO:0005737	0.862	cytoplasm
GO:0043229	0.855	intracellular organelle
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0042383	0.808	sarcolemma
GO:0005890	0.800	sodium:potassium-exchanging ATPase complex
GO:0031982	0.789	vesicle
GO:0012505	0.738	endomembrane system
GO:0030315	0.708	T-tubule
GO:0005576	0.647	extracellular region
GO:0098590	0.528	plasma membrane region
GO:0042995	0.456	cell projection
GO:1903561	0.396	extracellular vesicle
GO:0031090	0.350	organelle membrane
GO:0030054	0.331	cell junction
GO:0005615	0.325	extracellular space
GO:0120025	0.321	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18353	0.998	ATP + H2O + K(+)(out) + Na(+)(in) = ADP + H(+) + K(+)(in) + Na(+)(out) + phosphate
EC:7.2.2.13	0.998	Na(+)/K(+)-exchanging ATPase.

[back to server]