StarFunc result for job id P51114

User Input

>input (621 residues)
MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEIS
EGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKT
VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKR
VNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSN
IQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKN
GKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKE
VEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS
DWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLL
DNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADY
ISRAESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGE
EKINTLKEENTQEAAVLNGVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51114	1.000	1.000	2.203E-102	621	1.000	1.000	P51114.pdb.gz	FXR1_HUMAN RNA-binding protein FXR1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=3
2	AFDB:Q61584	0.677	0.623	9.746E-94	677	0.981	0.900	Q61584.pdb.gz	FXR1_MOUSE RNA-binding protein FXR1 OS=Mus musculus OX=10090 GN=Fxr1 PE=1 SV=2
3	AFDB:P51115	0.674	0.621	3.917E-88	676	0.882	0.811	P51115.pdb.gz	FXR1A_XENLA RNA-binding protein fxr1-A OS=Xenopus laevis OX=8355 GN=fxr1-a PE=1 SV=2
4	AFDB:Q6NUW6	0.517	0.499	4.184E-75	646	0.709	0.681	Q6NUW6.pdb.gz
5	AFDB:F1R159	0.364	0.395	9.540E-63	569	0.546	0.596	F1R159.pdb.gz
6	AFDB:Q6GLC9	0.398	0.417	1.750E-62	590	0.568	0.598	Q6GLC9.pdb.gz	FMR1_XENTR Fragile X messenger ribonucleoprotein 1 homolog OS=Xenopus tropicalis OX=8364 GN=fmr1 PE=2 SV=1
7	AFDB:P51113	0.384	0.419	5.571E-62	564	0.556	0.612	P51113.pdb.gz	FMR1A_XENLA Fragile X messenger ribonucleoprotein 1 homolog A OS=Xenopus laevis OX=8355 GN=fmr1-a PE=1 SV=1
8	AFDB:Q7SYM7	0.468	0.563	4.056E-61	493	0.478	0.602	Q7SYM7.pdb.gz
9	AFDB:Q06787	0.413	0.407	4.286E-61	632	0.560	0.551	Q06787.pdb.gz	FMR1_HUMAN Fragile X messenger ribonucleoprotein 1 OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1
10	AFDB:Q80WE1	0.393	0.410	1.036E-60	593	0.568	0.595	Q80WE1.pdb.gz	FMR1_RAT Fragile X messenger ribonucleoprotein 1 OS=Rattus norvegicus OX=10116 GN=Fmr1 PE=1 SV=2
11	PDB:7okyZ	0.079	0.128	2.778E-3	374	0.029	0.048	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
12	PDB:6tedZ	0.079	0.095	4.087E-3	510	0.034	0.041	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
13	PDB:3mp8A	0.147	0.174	7.094E-3	513	0.031	0.037	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
14	PDB:7abi7	0.080	0.189	8.370E-3	236	0.019	0.051	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
15	PDB:7ajuJJ	0.092	0.250	8.845E-3	199	0.052	0.161	7ajuJJ.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:6w17D	0.114	0.202	9.346E-3	301	0.066	0.136	6w17D.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.
17	PDB:7r1dC	0.082	0.248	9.346E-3	192	0.014	0.047	7r1dC.pdb.gz
18	PDB:6ke6RC	0.133	0.240	1.375E-2	278	0.042	0.094	6ke6RC.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
19	PDB:2io9B	0.086	0.088	2.816E-2	603	0.043	0.045	2io9B.pdb.gz	Dual binding sites for translocation catalysis by Escherichia coli glutathionylspermidine synthetase
20	PDB:5wq8A	0.120	0.139	2.976E-2	496	0.045	0.056	5wq8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MQB8	0.0	617	582	0.504	0.538	A8MQB8_HUMAN Fragile X messenger ribonucleoprotein 1 OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1
2	B4DXZ6	0.0	1250	608	0.973	0.993	B4DXZ6_HUMAN FMR1 autosomal homolog 1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=1
3	E7EU85	0.0	927	454	0.723	0.989	E7EU85_HUMAN FMR1 autosomal homolog 1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=1
4	E9PFF5	0.0	983	490	0.781	0.990	E9PFF5_HUMAN FMR1 autosomal homolog 1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=1
5	F1QLR3	0.0	829	622	0.704	0.703	FXR1_DANRE RNA-binding protein FXR1 OS=Danio rerio OX=7955 GN=fxr1 PE=1 SV=1
6	G3V0J0	0.0	631	592	0.517	0.542	G3V0J0_HUMAN Fragile X mental retardation 1, isoform CRA_e OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1
7	P35922	0.0	529	614	0.398	0.402	FMR1_MOUSE Fragile X messenger ribonucleoprotein 1 OS=Mus musculus OX=10090 GN=Fmr1 PE=1 SV=1
8	P51113	0.0	648	564	0.509	0.560	FMR1A_XENLA Fragile X messenger ribonucleoprotein 1 homolog A OS=Xenopus laevis OX=8355 GN=fmr1-a PE=1 SV=1
9	P51114	0.0	1284	621	1.000	1.000	FXR1_HUMAN RNA-binding protein FXR1 OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=3
10	P51115	0.0	995	676	0.870	0.799	FXR1A_XENLA RNA-binding protein fxr1-A OS=Xenopus laevis OX=8355 GN=fxr1-a PE=1 SV=2
11	P51116	0.0	694	673	0.639	0.590	FXR2_HUMAN RNA-binding protein FXR2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2
12	Q06787	0.0	530	632	0.398	0.391	FMR1_HUMAN Fragile X messenger ribonucleoprotein 1 OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1
13	Q5BJ56	0.0	983	674	0.866	0.798	FXR1_XENTR RNA-binding protein fxr1 OS=Xenopus tropicalis OX=8364 GN=fxr1 PE=2 SV=2
14	Q61584	0.0	1229	677	0.981	0.900	FXR1_MOUSE RNA-binding protein FXR1 OS=Mus musculus OX=10090 GN=Fxr1 PE=1 SV=2
15	Q6GLC9	0.0	647	590	0.517	0.544	FMR1_XENTR Fragile X messenger ribonucleoprotein 1 homolog OS=Xenopus tropicalis OX=8364 GN=fmr1 PE=2 SV=1
16	Q80WE1	0.0	641	593	0.520	0.545	FMR1_RAT Fragile X messenger ribonucleoprotein 1 OS=Rattus norvegicus OX=10116 GN=Fmr1 PE=1 SV=2
17	Q9DF20	0.0	617	569	0.485	0.529	Q9DF20_DANRE KH domain containing RNA-binding protein FMR1 OS=Danio rerio OX=7955 GN=zFMR1 PE=1 SV=1
18	Q9WVR4	0.0	678	673	0.625	0.577	FXR2_MOUSE RNA-binding protein FXR2 OS=Mus musculus OX=10090 GN=Fxr2 PE=1 SV=1
19	Q8IXW7	3.67e-162	467	297	0.351	0.734	Q8IXW7_HUMAN FMR1 protein OS=Homo sapiens OX=9606 GN=FMR1 PE=1 SV=1
20	H7C4S4	2.45e-145	422	246	0.351	0.886	H7C4S4_HUMAN FMR1 autosomal homolog 1 (Fragment) OS=Homo sapiens OX=9606 GN=FXR1 PE=1 SV=8

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05641 Agenet	1.8e-11	55.7	Agenet domain
2	PF12235 FXMRP1_C_core	1.9e-30	117.6	Fragile X-related 1 protein core C terminal
3	PF16096 FXR_C1	6.8e-36	133.6	Fragile X-related 1 protein C-terminal region 2
4	PF16097 FXR_C3	2.7e-25	100.2	Fragile X-related 1 protein C-terminal region 3
5	PF00013 KH_1	2.5e-13	60.9	KH domain
6	PF07650 KH_2	0.56	21.4	KH domain
7	PF13083 KH_4	79	14.6	KH domain
8	PF17904 KH_9	1.8e-33	126.1	FMRP KH0 domain
9	PF18104 Tudor_2	4e+02	12.1	Jumonji domain-containing protein 2A Tudor domain
10	PF18336 Tudor_FRX1	1.7e-27	106.5	Fragile X mental retardation Tudor domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350170

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220592	0.996	Protein argonaute-2
2	9606.ENSP00000444645	0.986	Cytoplasmic FMR1-interacting protein 2
3	9606.ENSP00000481038	0.978	Cytoplasmic FMR1-interacting protein 1
4	9606.ENSP00000250113	0.977	Fragile X mental retardation syndrome-related protein 2
5	9606.ENSP00000359506	0.976	Synaptic functional regulator FMR1
6	9606.ENSP00000440190	0.945	Tudor domain-containing protein 3
7	9606.ENSP00000381412	0.934	Calcium/calmodulin-dependent protein kinase type II subunit alpha
8	9606.ENSP00000319060	0.925	Calcium/calmodulin-dependent protein kinase type II subunit gamma
9	9606.ENSP00000339740	0.925	Calcium/calmodulin-dependent protein kinase type II subunit delta
10	9606.ENSP00000379098	0.925	Calcium/calmodulin-dependent protein kinase type II subunit beta
11	9606.ENSP00000251849	0.905	RAF proto-oncogene serine/threonine-protein kinase
12	9606.ENSP00000290277	0.905	Serine/threonine-protein kinase A-Raf
13	9606.ENSP00000371067	0.903	Tyrosine-protein kinase JAK2
14	9606.ENSP00000437256	0.867	Endoribonuclease Dicer
15	9606.ENSP00000340329	0.852	Caprin-1
16	9606.ENSP00000389445	0.833	Ubiquitin-associated protein 2-like
17	9606.ENSP00000377681	0.822	Ras GTPase-activating protein-binding protein 1
18	9606.ENSP00000346762	0.817	Staphylococcal nuclease domain-containing protein 1
19	9606.ENSP00000365439	0.800	Heterogeneous nuclear ribonucleoprotein K
20	9606.ENSP00000362300	0.799	Protein argonaute-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0042802	0.871	identical protein binding
GO:0046983	0.814	protein dimerization activity
GO:0140666	0.801	annealing activity
GO:0046982	0.792	protein heterodimerization activity
GO:0042803	0.785	protein homodimerization activity
GO:0003727	0.746	single-stranded RNA binding
GO:0033592	0.384	RNA strand annealing activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.960	developmental process
GO:0048856	0.954	anatomical structure development
GO:0050789	0.915	regulation of biological process
GO:0061061	0.890	muscle structure development
GO:0009987	0.887	cellular process
GO:0019222	0.827	regulation of metabolic process
GO:0048513	0.792	animal organ development
GO:0060255	0.783	regulation of macromolecule metabolic process
GO:0010468	0.670	regulation of gene expression
GO:0050794	0.669	regulation of cellular process
GO:0007517	0.576	muscle organ development
GO:0048518	0.498	positive regulation of biological process
GO:0080090	0.439	regulation of primary metabolic process
GO:0051171	0.438	regulation of nitrogen compound metabolic process
GO:0031323	0.370	regulation of cellular metabolic process
GO:0048522	0.308	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.999	nucleus
GO:0032991	0.935	protein-containing complex
GO:0070013	0.933	intracellular organelle lumen
GO:0016020	0.792	membrane
GO:1990904	0.769	ribonucleoprotein complex
GO:0043232	0.747	intracellular non-membrane-bounded organelle
GO:0005844	0.518	polysome
GO:0031981	0.429	nuclear lumen
GO:0099080	0.330	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]