StarFunc result for job id P51153

User Input

>input (203 residues)
MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNNTYISTIGIDFKIRTVDIEGKKIKLQ
VWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLG
NKCDMEAKRKVQKEQADKLAREHGIRFFETSAKSSMNVDEAFSSLARDILLKSGGRRSGN
GNKPPSTDLKTCDKKNTNKCSLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1PTE3	0.891	0.891	2.361E-41	203	0.951	0.951	F1PTE3.pdb.gz	RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris OX=9615 GN=RAB13 PE=1 SV=2
2	AFDB:Q9DD03	0.891	0.896	5.675E-40	202	0.916	0.921	Q9DD03.pdb.gz	RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus OX=10090 GN=Rab13 PE=1 SV=1
3	AFDB:Q7T3A4	0.870	0.883	1.003E-34	200	0.778	0.790	Q7T3A4.pdb.gz	RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio OX=7955 GN=rab13 PE=1 SV=1
4	AFDB:O18338	0.867	0.851	2.737E-33	207	0.650	0.638	O18338.pdb.gz	O18338_DROME LD44762p OS=Drosophila melanogaster OX=7227 GN=Rab8 PE=1 SV=1
5	AFDB:A5PLC7	0.856	0.832	4.788E-32	209	0.655	0.636	A5PLC7.pdb.gz	A5PLC7_DANRE RAB8B, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8bb PE=1 SV=1
6	AFDB:G5EFC1	0.835	0.804	7.963E-32	211	0.616	0.592	G5EFC1.pdb.gz	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
7	AFDB:A4FVK4	0.853	0.836	2.501E-31	207	0.626	0.614	A4FVK4.pdb.gz	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
8	AFDB:A1L2A5	0.859	0.947	2.630E-30	184	0.611	0.674	A1L2A5.pdb.gz
9	AFDB:D6XMQ7	0.859	0.839	1.374E-29	208	0.517	0.505	D6XMQ7.pdb.gz	D6XMQ7_TRYB2 Small GTP-binding protein Rab1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.530 PE=4 SV=1
10	AFDB:Q6DGV5	0.821	0.829	2.766E-29	201	0.616	0.622	Q6DGV5.pdb.gz	Q6DGV5_DANRE RAB10, member RAS oncogene family OS=Danio rerio OX=7955 GN=zgc:92757 PE=1 SV=1
11	PDB:5szjA	0.818	0.947	3.227E-28	175	0.596	0.691	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
12	PDB:5sziA	0.830	0.966	8.925E-28	174	0.586	0.684	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:5szhB	0.824	0.953	6.408E-27	175	0.478	0.554	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:6if2B	0.837	0.951	2.730E-25	178	0.458	0.522	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
15	PDB:2f9mA	0.830	0.924	1.426E-24	182	0.384	0.429	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
16	PDB:1zbdA	0.843	0.963	2.528E-24	177	0.429	0.492	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
17	PDB:1ukvY	0.795	0.819	6.076E-23	197	0.473	0.487	1ukvY.pdb.gz	Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
18	PDB:2ew1A	0.804	0.951	7.836E-23	171	0.394	0.468	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
19	PDB:8a4cB	0.806	0.960	1.148E-22	170	0.433	0.518	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
20	PDB:2zetA	0.791	0.883	1.791E-22	181	0.379	0.425	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51153	8.99e-151	418	203	1.000	1.000	RAB13_HUMAN Ras-related protein Rab-13 OS=Homo sapiens OX=9606 GN=RAB13 PE=1 SV=1
2	F1PTE3	2.29e-142	397	203	0.951	0.951	RAB13_CANLF Ras-related protein Rab-13 OS=Canis lupus familiaris OX=9615 GN=RAB13 PE=1 SV=2
3	P35286	1.95e-140	392	203	0.926	0.926	RAB13_RAT Ras-related protein Rab-13 OS=Rattus norvegicus OX=10116 GN=Rab13 PE=1 SV=2
4	Q9DD03	3.13e-135	379	202	0.916	0.921	RAB13_MOUSE Ras-related protein Rab-13 OS=Mus musculus OX=10090 GN=Rab13 PE=1 SV=1
5	Q7T3A4	1.88e-115	328	200	0.778	0.790	RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio OX=7955 GN=rab13 PE=1 SV=1
6	A5PLC7	4.93e-95	277	209	0.640	0.622	A5PLC7_DANRE RAB8B, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8bb PE=1 SV=1
7	P61028	1.39e-94	276	207	0.665	0.652	RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus OX=10090 GN=Rab8b PE=1 SV=1
8	P70550	1.39e-94	276	207	0.665	0.652	RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus OX=10116 GN=Rab8b PE=1 SV=1
9	O18338	2.38e-94	275	207	0.650	0.638	O18338_DROME LD44762p OS=Drosophila melanogaster OX=7227 GN=Rab8 PE=1 SV=1
10	Q92930	2.75e-94	275	207	0.626	0.614	RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens OX=9606 GN=RAB8B PE=1 SV=2
11	P35280	2.85e-92	270	207	0.640	0.628	RAB8A_RAT Ras-related protein Rab-8A OS=Rattus norvegicus OX=10116 GN=Rab8a PE=1 SV=2
12	P55258	2.85e-92	270	207	0.640	0.628	RAB8A_MOUSE Ras-related protein Rab-8A OS=Mus musculus OX=10090 GN=Rab8a PE=1 SV=2
13	A4FVK4	6.76e-92	269	207	0.611	0.599	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
14	P61006	2.75e-91	268	207	0.611	0.599	RAB8A_HUMAN Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A PE=1 SV=1
15	P61007	2.75e-91	268	207	0.611	0.599	RAB8A_CANLF Ras-related protein Rab-8A OS=Canis lupus familiaris OX=9615 GN=RAB8A PE=1 SV=1
16	G5EFC1	4.18e-91	267	211	0.596	0.573	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
17	Q6DGV5	2.29e-88	260	201	0.601	0.607	Q6DGV5_DANRE RAB10, member RAS oncogene family OS=Danio rerio OX=7955 GN=zgc:92757 PE=1 SV=1
18	P61026	3.81e-87	257	200	0.591	0.600	RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens OX=9606 GN=RAB10 PE=1 SV=1
19	P61027	3.81e-87	257	200	0.591	0.600	RAB10_MOUSE Ras-related protein Rab-10 OS=Mus musculus OX=10090 GN=Rab10 PE=1 SV=1
20	O15971	3.86e-87	257	204	0.601	0.598	O15971_DROME LD39986p OS=Drosophila melanogaster OX=7227 GN=Rab10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	62	15.5	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	1.5e+02	14.1	AAA ATPase domain
3	PF13401 AAA_22	89	14.8	AAA domain
4	PF07728 AAA_5	4.9e+02	12.1	AAA domain (dynein-related subfamily)
5	PF12775 AAA_7	18	16.3	P-loop containing dynein motor region
6	PF00025 Arf	2.5e-15	67.9	ADP-ribosylation factor family
7	PF02421 FeoB_N	2.1e+02	12.8	Ferrous iron transport protein B
8	PF00009 GTP_EFTU	0.017	26.2	Elongation factor Tu GTP binding domain
9	PF04670 Gtr1_RagA	4.8e-05	34.4	Gtr1/RagA G protein conserved region
10	PF01926 MMR_HSR1	0.22	23.0	50S ribosome-binding GTPase
11	PF10662 PduV-EutP	0.7	21.1	Ethanolamine utilisation - propanediol utilisation
12	PF00071 Ras	3.8e-63	223.4	Ras family
13	PF08477 Roc	1.8e-31	120.2	Ras of Complex, Roc, domain of DAPkinase
14	PF03193 RsgA_GTPase	0.027	25.9	RsgA GTPase
15	PF00735 Septin	18	16.1	Septin
16	PF09439 SRPRB	0.019	25.9	Signal recognition particle receptor beta subunit
17	PF05621 TniB	1.2e+02	13.5	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008565817.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008572466.1	0.947	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 76% coverage of the annotated genomic feature by RNAseq alignments
2	482537.XP_008581351.1	0.900	dnaJ homolog subfamily C member 14 isoform X1
3	482537.XP_008574042.1	0.826	DENN domain-containing protein 1C
4	482537.XP_008575643.1	0.806	Homeobox protein cut-like 2
5	482537.XP_008592828.1	0.806	Protein CASP
6	482537.XP_008565816.1	0.780	40S ribosomal protein S27
7	482537.XP_008583404.1	0.776	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008587892.1	0.759	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 45 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008580685.1	0.748	Exocyst complex component 7
10	482537.XP_008587159.1	0.745	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 13 mRNAs, 27 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
11	482537.XP_008587463.1	0.744	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 10 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
12	482537.XP_008570596.1	0.743	TBC1 domain family member 4 isoform X1
13	482537.XP_008567641.1	0.739	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 26 mRNAs, 24 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008589242.1	0.722	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 2 Proteins, and 94% coverage of the annotated genomic feature by RNAseq alignments
15	482537.XP_008567218.1	0.721	Exocyst complex component 6
16	482537.XP_008568085.1	0.716	Exocyst complex component 8
17	482537.XP_008566000.1	0.713	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
18	482537.XP_008575003.1	0.712	Ras-related protein Rab-33A isoform X1
19	482537.XP_008576940.1	0.711	Mitogen-activated protein kinase kinase kinase 11
20	482537.XP_008580214.1	0.710	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.907	heterocyclic compound binding
GO:0097159	0.907	organic cyclic compound binding
GO:0019001	0.837	guanyl nucleotide binding
GO:0003824	0.826	catalytic activity
GO:0043168	0.820	anion binding
GO:0032561	0.817	guanyl ribonucleotide binding
GO:0017111	0.768	ribonucleoside triphosphate phosphatase activity
GO:0005525	0.550	GTP binding
GO:0003924	0.496	GTPase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0051641	0.950	cellular localization
GO:0065007	0.946	biological regulation
GO:0051668	0.929	localization within membrane
GO:0050789	0.906	regulation of biological process
GO:0006810	0.904	transport
GO:0071840	0.896	cellular component organization or biogenesis
GO:0050896	0.809	response to stimulus
GO:0050794	0.796	regulation of cellular process
GO:0032456	0.782	endocytic recycling
GO:0072657	0.755	protein localization to membrane
GO:0016043	0.741	cellular component organization
GO:0034330	0.731	cell junction organization
GO:1990778	0.715	protein localization to cell periphery
GO:0045216	0.677	cell-cell junction organization
GO:0120193	0.614	tight junction organization
GO:0032502	0.430	developmental process
GO:0032501	0.402	multicellular organismal process
GO:0051716	0.324	cellular response to stimulus
GO:0007043	0.301	cell-cell junction assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.998	membrane
GO:0012505	0.997	endomembrane system
GO:0031982	0.996	vesicle
GO:0031410	0.989	cytoplasmic vesicle
GO:0005886	0.980	plasma membrane
GO:0005829	0.836	cytosol
GO:0031090	0.718	organelle membrane
GO:0005768	0.448	endosome
GO:0042995	0.393	cell projection
GO:0055037	0.379	recycling endosome
GO:0030054	0.370	cell junction
GO:0120025	0.336	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23680	0.768	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.768	nucleoside-triphosphate phosphatase.
RHEA:19669	0.496	GTP + H2O = GDP + H(+) + phosphate

[back to server]