StarFunc result for job id P51160

User Input

>input (858 residues)
MGEINQVAVEKYLEENPQFAKEYFDRKLRVEVLGEIFKNSQVPVQSSMSFSELTQVEESA
LCLELLWTVQEEGGTPEQGVHRALQRLAHLLQADRCSMFLCRSRNGIPEVASRLLDVTPT
SKFEDNLVGPDKEVVFPLDIGIVGWAAHTKKTHNVPDVKKNSHFSDFMDKQTGYVTKNLL
ATPIVVGKEVLAVIMAVNKVNASEFSKQDEEVFSKYLNFVSIILRLHHTSYMYNIESRRS
QILMWSANKVFEELTDVERQFHKALYTVRSYLNCERYSIGLLDMTKEKEFYDEWPIKLGE
VEPYKGPKTPDGREVNFYKIIDYILHGKEEIKVIPTPPADHWTLISGLPTYVAENGFICN
MMNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEY
ITETLTQFLGWSLLNTDTYDKMNKLENRKDIAQEMLMNQTKATPEEIKSILKFQEKLNVD
VIDDCEEKQLVAILKEDLPDPRSAELYEFRFSDFPLTEHGLIKCGIRLFFEINVVEKFKV
PVEVLTRWMYTVRKGYRAVTYHNWRHGFNVGQTMFTLLMTGRLKKYYTDLEAFAMLAAAF
CHDIDHRGTNNLYQMKSTSPLARLHGSSILERHHLEYSKTLLQDESLNIFQNLNKRQFET
VIHLFEVAIIATDLALYFKKRTMFQKIVDACEQMQTEEEAIKYVTVDPTKKEIIMAMMMT
ACDLSAITKPWEVQSQVALMVANEFWEQGDLERTVLQQQPIPMMDRNKRDELPKLQVGFI
DFVCTFVYKEFSRFHKEITPMLSGLQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKA
AEDSGGGDDKKSKTCLML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51160	1.000	1.000	0.000	858	1.000	1.000	P51160.pdb.gz	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
2	AFDB:Q91ZQ1	0.489	0.487	0.000	861	0.865	0.862	Q91ZQ1.pdb.gz	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
3	AFDB:A0A0R4IUY2	0.901	0.907	8.459E-104	852	0.691	0.696	A0A0R4IUY2.pdb.gz
4	AFDB:P16499	0.978	0.976	6.948E-103	860	0.636	0.635	P16499.pdb.gz	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
5	AFDB:D3ZDI8	0.881	0.883	4.922E-99	856	0.647	0.648	D3ZDI8.pdb.gz	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
6	PDB:6mzbB	0.876	0.930	3.612E-88	807	0.628	0.668	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
7	PDB:7jsnA	0.917	0.958	6.731E-87	820	0.615	0.644	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
8	AFDB:Q9VFI9	0.662	0.523	4.937E-57	1118	0.316	0.242	Q9VFI9.pdb.gz	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
9	AFDB:Q9VJ79	0.622	0.393	4.582E-53	1451	0.307	0.181	Q9VJ79.pdb.gz	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
10	AFDB:Q8VID6	0.570	0.530	2.534E-52	935	0.303	0.278	Q8VID6.pdb.gz	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
11	AFDB:O76074	0.602	0.592	8.866E-51	875	0.301	0.295	O76074.pdb.gz	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
12	AFDB:Q9QYJ6	0.545	0.583	7.869E-41	794	0.218	0.236	Q9QYJ6.pdb.gz	PDE10_RAT cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A OS=Rattus norvegicus OX=10116 GN=Pde10a PE=1 SV=1
13	PDB:3bjcA	0.330	0.886	3.009E-21	311	0.147	0.405	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
14	PDB:4y86B	0.359	0.928	1.299E-17	326	0.097	0.255	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
15	PDB:7rzwB	0.188	0.187	1.691E-4	864	0.084	0.083	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
16	PDB:1f5mB	0.159	0.662	2.423E-4	177	0.041	0.198	1f5mB.pdb.gz
17	PDB:1vhmB	0.144	0.631	7.465E-4	160	0.030	0.163	1vhmB.pdb.gz
18	PDB:5loeA	0.146	0.396	2.300E-3	258	0.041	0.136	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
19	PDB:4zmuA	0.149	0.340	4.517E-3	341	0.036	0.091	4zmuA.pdb.gz
20	PDB:2w1tA	0.103	0.415	2.086E-2	175	0.021	0.103	2w1tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZDI8	0.0	1158	856	0.656	0.658	D3ZDI8_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde6b PE=3 SV=1
2	P11541	0.0	1136	859	0.631	0.630	PDE6A_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Bos taurus OX=9913 GN=PDE6A PE=1 SV=3
3	P16499	0.0	1162	860	0.639	0.637	PDE6A_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Homo sapiens OX=9606 GN=PDE6A PE=1 SV=4
4	P23439	0.0	1178	853	0.647	0.651	PDE6B_BOVIN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Bos taurus OX=9913 GN=PDE6B PE=1 SV=1
5	P23440	0.0	1157	856	0.650	0.652	PDE6B_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Mus musculus OX=10090 GN=Pde6b PE=2 SV=3
6	P27664	0.0	1137	859	0.633	0.632	PDE6A_MOUSE Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha OS=Mus musculus OX=10090 GN=Pde6a PE=2 SV=3
7	P35913	0.0	1160	854	0.641	0.644	PDE6B_HUMAN Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta OS=Homo sapiens OX=9606 GN=PDE6B PE=1 SV=2
8	P51160	0.0	1793	858	1.000	1.000	PDE6C_HUMAN Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Homo sapiens OX=9606 GN=PDE6C PE=1 SV=2
9	Q6P4P8	0.0	1259	852	0.686	0.691	Q6P4P8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=zgc:73085 PE=1 SV=1
10	Q91ZQ1	0.0	1568	861	0.872	0.869	PDE6C_MOUSE Cone cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha' OS=Mus musculus OX=10090 GN=Pde6c PE=2 SV=1
11	Q9VFI9	2.21e-148	468	1118	0.321	0.246	PDE6_DROME cGMP-specific 3',5'-cyclic phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=Pde6 PE=1 SV=4
12	Q8VID6	3.08e-135	428	935	0.294	0.270	PDE11_RAT Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Rattus norvegicus OX=10116 GN=Pde11a PE=1 SV=1
13	Q9HCR9	6.76e-135	427	933	0.295	0.271	PDE11_HUMAN Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2
14	Q9VJ79	1.42e-126	416	1451	0.300	0.177	PDE11_DROME Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11 OS=Drosophila melanogaster OX=7227 GN=Pde11 PE=1 SV=4
15	O54735	5.56e-121	387	833	0.300	0.309	PDE5A_RAT cGMP-specific 3',5'-cyclic phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde5a PE=2 SV=1
16	O76074	3.06e-119	384	875	0.282	0.277	PDE5A_HUMAN cGMP-specific 3',5'-cyclic phosphodiesterase OS=Homo sapiens OX=9606 GN=PDE5A PE=1 SV=2
17	Q8CG03	2.35e-118	381	865	0.301	0.298	PDE5A_MOUSE cGMP-specific 3',5'-cyclic phosphodiesterase OS=Mus musculus OX=10090 GN=Pde5a PE=1 SV=2
18	P14099	2.04e-77	272	921	0.227	0.212	PDE2A_BOVIN cGMP-dependent 3',5'-cyclic phosphodiesterase OS=Bos taurus OX=9913 GN=PDE2A PE=1 SV=2
19	G1U4Q4	3.96e-77	271	936	0.227	0.208	G1U4Q4_RABIT Phosphodiesterase OS=Oryctolagus cuniculus OX=9986 GN=PDE2A PE=3 SV=2
20	B3VTJ2	1.34e-75	267	941	0.231	0.210	B3VTJ2_MACMU Phosphodiesterase OS=Macaca mulatta OX=9544 GN=PDE2A3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01590 GAF	6.6e-22	90.0	GAF domain
2	PF13185 GAF_2	0.00018	33.2	GAF domain
3	PF13492 GAF_3	0.65	21.8	GAF domain
4	PF00233 PDEase_I	3.3e-68	241.5	3'5'-cyclic nucleotide phosphodiesterase
5	PF15714 SpoVT_C	40	15.7	Stage V sporulation protein T C-terminal, transcription factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360502

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316605	0.994	Cyclic nucleotide-gated cation channel beta-3
2	9606.ENSP00000377140	0.991	Cyclic nucleotide-gated cation channel alpha-3
3	9606.ENSP00000251337	0.990	Guanine nucleotide-binding protein G(t) subunit alpha-2
4	9606.ENSP00000266395	0.990	Retinal cone rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
5	9606.ENSP00000334134	0.943	Regulator of G-protein signaling 9-binding protein
6	9606.ENSP00000261837	0.910	Guanine nucleotide-binding protein subunit beta-5
7	9606.ENSP00000248572	0.908	Guanine nucleotide-binding protein G(T) subunit gamma-T1
8	9606.ENSP00000262406	0.901	Regulator of G-protein signaling 9
9	9606.ENSP00000254854	0.864	Retinal guanylyl cyclase 1
10	9606.ENSP00000355689	0.856	Guanylate kinase
11	9606.ENSP00000248564	0.851	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
12	9606.ENSP00000360488	0.818	Protein FRA10AC1
13	9606.ENSP00000218006	0.809	Retinal guanylyl cyclase 2
14	9606.ENSP00000328412	0.795	Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma
15	9606.ENSP00000356825	0.775	Adenylate cyclase type 10
16	9606.ENSP00000251102	0.762	Cyclic nucleotide-gated cation channel beta-1
17	9606.ENSP00000341083	0.761	Atrial natriuretic peptide receptor 2
18	9606.ENSP00000294016	0.752	Adenylate cyclase type 9
19	9606.ENSP00000264424	0.741	Guanylate cyclase soluble subunit beta-1
20	9606.ENSP00000312126	0.740	Adenylate cyclase type 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0047555	0.991	3',5'-cyclic-GMP phosphodiesterase activity
GO:0005488	0.988	binding
GO:0005515	0.963	protein binding
GO:0004115	0.948	3',5'-cyclic-AMP phosphodiesterase activity
GO:0043167	0.538	ion binding
GO:1901363	0.537	heterocyclic compound binding
GO:0097159	0.537	organic cyclic compound binding
GO:0043168	0.520	anion binding
GO:0030553	0.507	cGMP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.986	multicellular organismal process
GO:0003008	0.975	system process
GO:0050953	0.966	sensory perception of light stimulus
GO:0007601	0.952	visual perception
GO:0048856	0.821	anatomical structure development
GO:0009987	0.799	cellular process
GO:0065007	0.727	biological regulation
GO:0007275	0.721	multicellular organism development
GO:0001895	0.676	retina homeostasis
GO:0050789	0.675	regulation of biological process
GO:0050896	0.647	response to stimulus
GO:0050794	0.628	regulation of cellular process
GO:0051716	0.548	cellular response to stimulus
GO:0007165	0.527	signal transduction
GO:0060041	0.483	retina development in camera-type eye
GO:0060042	0.419	retina morphogenesis in camera-type eye

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005929	0.998	cilium
GO:0043005	0.991	neuron projection
GO:0097733	0.967	photoreceptor cell cilium
GO:0001750	0.955	photoreceptor outer segment
GO:0031090	0.895	organelle membrane
GO:0097381	0.652	photoreceptor disc membrane
GO:0005622	0.571	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16957	0.991	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.35	0.991	3',5'-cyclic-GMP phosphodiesterase.
RHEA:25277	0.948	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	0.948	3',5'-cyclic-AMP phosphodiesterase.

[back to server]