StarFunc result for job id P51161

User Input

>input (128 residues)
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTM
TNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTY
ERVSKRLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51161	1.000	1.000	6.264E-22	128	1.000	1.000	P51161.pdb.gz	FABP6_HUMAN Gastrotropin OS=Homo sapiens OX=9606 GN=FABP6 PE=1 SV=2
2	PDB:2mm3A	0.880	0.887	3.887E-18	127	0.984	0.992	2mm3A.pdb.gz	Structural determinants of ligand binding in the ternary complex of human ileal bile acid binding protein with glycocholate and glycochenodeoxycholate obtained from solution NMR
3	AFDB:P51162	0.987	0.987	6.514E-18	128	0.797	0.797	P51162.pdb.gz	FABP6_MOUSE Gastrotropin OS=Mus musculus OX=10090 GN=Fabp6 PE=2 SV=2
4	AFDB:B2ZHD9	0.934	0.913	1.960E-14	131	0.570	0.557	B2ZHD9.pdb.gz
5	PDB:3elzB	0.885	0.842	2.174E-14	135	0.562	0.533	3elzB.pdb.gz	The X-Ray structure of zebrafish (Danio rerio) ileal bile acid-binding protein reveals the presence of binding sites on the surface of the protein molecule.
6	PDB:2qo5A	0.947	0.940	5.234E-14	129	0.406	0.403	2qo5A.pdb.gz
7	AFDB:Q9I8L5	0.950	0.964	1.630E-13	126	0.414	0.421	Q9I8L5.pdb.gz	FA10A_DANRE Fatty acid-binding protein 10-A, liver basic OS=Danio rerio OX=7955 GN=fabp10a PE=1 SV=1
8	AFDB:Q4VBT1	0.961	0.961	5.933E-13	128	0.391	0.391	Q4VBT1.pdb.gz	FA1B1_DANRE Fatty acid binding protein 1-B.1 OS=Danio rerio OX=7955 GN=fabp1b.1 PE=2 SV=1
9	AFDB:P07148	0.949	0.956	7.296E-13	127	0.359	0.362	P07148.pdb.gz	FABPL_HUMAN Fatty acid-binding protein, liver OS=Homo sapiens OX=9606 GN=FABP1 PE=1 SV=1
10	PDB:1lfoA	0.928	0.928	1.757E-12	128	0.352	0.352	1lfoA.pdb.gz	The crystal structure of the liver fatty acid-binding protein. A complex with two bound oleates.
11	AFDB:P02692	0.938	0.945	1.947E-12	127	0.352	0.354	P02692.pdb.gz	FABPL_RAT Fatty acid-binding protein, liver OS=Rattus norvegicus OX=10116 GN=Fabp1 PE=1 SV=1
12	PDB:6mp4E	0.921	0.863	4.229E-12	137	0.359	0.336	6mp4E.pdb.gz	Liver fatty acid-binding protein regulates THC metabolism by facilitating intracellular hepatic transport
13	AFDB:P05413	0.903	0.871	3.517E-11	133	0.266	0.256	P05413.pdb.gz	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
14	AFDB:A0A0R4IRM6	0.917	0.917	4.795E-11	128	0.336	0.336	A0A0R4IRM6.pdb.gz	A0A0R4IRM6_DANRE Fatty acid-binding protein, liver OS=Danio rerio OX=7955 GN=fabp1b.2 PE=3 SV=1
15	AFDB:P07483	0.905	0.873	5.317E-11	133	0.281	0.271	P07483.pdb.gz	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
16	PDB:5ggeA	0.866	0.860	1.658E-10	129	0.258	0.256	5ggeA.pdb.gz
17	PDB:7yf1A	0.903	0.871	1.658E-10	133	0.266	0.256	7yf1A.pdb.gz
18	PDB:5hz9A	0.905	0.861	2.039E-10	135	0.266	0.252	5hz9A.pdb.gz	Design and synthesis of selective, dual fatty acid binding protein 4 and 5 inhibitors.
19	PDB:2rctA	0.872	0.796	9.607E-10	141	0.297	0.270	2rctA.pdb.gz	Crystal structure of human cellular retinol-binding protein II to 1.2 A resolution.
20	PDB:7e25A	0.876	0.811	9.607E-10	139	0.227	0.209	7e25A.pdb.gz	Crystal structure of human brain-type fatty acid-binding protein FABP7 complexed with palmitic acid.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51161	1.10e-91	262	128	1.000	1.000	FABP6_HUMAN Gastrotropin OS=Homo sapiens OX=9606 GN=FABP6 PE=1 SV=2
2	P51162	9.06e-75	219	128	0.797	0.797	FABP6_MOUSE Gastrotropin OS=Mus musculus OX=10090 GN=Fabp6 PE=2 SV=2
3	P80020	5.79e-73	215	128	0.773	0.773	FABP6_RAT Gastrotropin OS=Rattus norvegicus OX=10116 GN=Fabp6 PE=1 SV=3
4	Q6IMW5	3.98e-48	152	131	0.547	0.534	Q6IMW5_DANRE Fatty acid-binding protein 6, ileal (gastrotropin) OS=Danio rerio OX=7955 GN=zgc:92421 PE=1 SV=1
5	Q9I8L5	3.52e-31	109	126	0.414	0.421	FA10A_DANRE Fatty acid-binding protein 10-A, liver basic OS=Danio rerio OX=7955 GN=fabp10a PE=1 SV=1
6	Q4VBT1	2.75e-28	102	128	0.398	0.398	FA1B1_DANRE Fatty acid binding protein 1-B.1 OS=Danio rerio OX=7955 GN=fabp1b.1 PE=2 SV=1
7	P07148	1.41e-27	100	127	0.367	0.370	FABPL_HUMAN Fatty acid-binding protein, liver OS=Homo sapiens OX=9606 GN=FABP1 PE=1 SV=1
8	Q6FGL7	1.41e-27	100	127	0.367	0.370	Q6FGL7_HUMAN Fatty acid-binding protein, liver (Fragment) OS=Homo sapiens OX=9606 GN=FABP1 PE=2 SV=1
9	P12710	7.50e-26	95.9	127	0.359	0.362	FABPL_MOUSE Fatty acid-binding protein, liver OS=Mus musculus OX=10090 GN=Fabp1 PE=1 SV=2
10	P02692	2.02e-25	95.1	127	0.367	0.370	FABPL_RAT Fatty acid-binding protein, liver OS=Rattus norvegicus OX=10116 GN=Fabp1 PE=1 SV=1
11	A8MW49	2.53e-22	87.0	124	0.336	0.347	A8MW49_HUMAN Fatty acid-binding protein, liver OS=Homo sapiens OX=9606 GN=FABP1 PE=1 SV=1
12	A0A0R4IRM6	3.72e-20	81.6	128	0.359	0.359	A0A0R4IRM6_DANRE Fatty acid-binding protein, liver OS=Danio rerio OX=7955 GN=fabp1b.2 PE=3 SV=1
13	O01812	9.95e-08	49.7	135	0.219	0.207	FABP6_CAEEL Fatty acid-binding protein homolog 6 OS=Caenorhabditis elegans OX=6239 GN=lbp-6 PE=1 SV=1
14	P12104	3.05e-07	48.1	132	0.273	0.265	FABPI_HUMAN Fatty acid-binding protein, intestinal OS=Homo sapiens OX=9606 GN=FABP2 PE=1 SV=2
15	P11404	3.63e-06	45.4	133	0.305	0.293	FABPH_MOUSE Fatty acid-binding protein, heart OS=Mus musculus OX=10090 GN=Fabp3 PE=1 SV=5
16	P05413	1.25e-05	43.9	133	0.219	0.211	FABPH_HUMAN Fatty acid-binding protein, heart OS=Homo sapiens OX=9606 GN=FABP3 PE=1 SV=4
17	P07483	1.89e-05	43.5	133	0.219	0.211	FABPH_RAT Fatty acid-binding protein, heart OS=Rattus norvegicus OX=10116 GN=Fabp3 PE=1 SV=2
18	B5XC78	2.70e-05	43.1	132	0.297	0.288	B5XC78_SALSA Fatty acid-binding protein, intestinal OS=Salmo salar OX=8030 GN=FABPI PE=2 SV=1
19	P02693	2.84e-05	42.7	132	0.289	0.280	FABPI_RAT Fatty acid-binding protein, intestinal OS=Rattus norvegicus OX=10116 GN=Fabp2 PE=1 SV=4
20	Q8UVG7	5.52e-05	42.0	133	0.211	0.203	Q8UVG7_DANRE Fatty acid-binding protein 3, muscle and heart OS=Danio rerio OX=7955 GN=H-FABP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11975 Glyco_hydro_4C	4.4e+02	12.2	Family 4 glycosyl hydrolase C-terminal domain
2	PF14651 Lipocalin_7	7.7e-78	270.1	Lipocalin / cytosolic fatty-acid binding protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000029875

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000010231	0.903	Uncharacterized protein
2	9598.ENSPTRP00000009088	0.865	Uncharacterized protein
3	9598.ENSPTRP00000000799	0.738	Fatty acid binding protein 3, muscle and heart (Mammary-derived growth inhibitor)
4	9598.ENSPTRP00000056218	0.723	Uncharacterized protein
5	9598.ENSPTRP00000015980	0.718	ATP binding cassette subfamily C member 3
6	9598.ENSPTRP00000045122	0.697	Retinoid X receptor, alpha
7	9598.ENSPTRP00000027149	0.677	Uncharacterized protein
8	9598.ENSPTRP00000034857	0.659	Fatty acid binding protein 4, adipocyte
9	9598.ENSPTRP00000034854	0.657	Fatty acid binding protein 5 (Psoriasis-associated)
10	9598.ENSPTRP00000007402	0.645	Apolipoprotein A-IV
11	9598.ENSPTRP00000000693	0.641	Uncharacterized protein
12	9598.ENSPTRP00000031694	0.639	Fatty acid binding protein 7, brain
13	9598.ENSPTRP00000006182	0.634	Uncharacterized protein
14	9598.ENSPTRP00000010999	0.626	Uncharacterized protein
15	9598.ENSPTRP00000013976	0.625	Aspartate aminotransferase
16	9598.ENSPTRP00000010145	0.619	ATP-binding cassette, sub-family C (CFTR/MRP), member 4
17	9598.ENSPTRP00000012256	0.612	Uncharacterized protein
18	9598.ENSPTRP00000027603	0.605	Uncharacterized protein
19	9598.ENSPTRP00000027919	0.605	Uncharacterized protein
20	9598.ENSPTRP00000053124	0.605	Solute carrier family 10, member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008289	1.000	lipid binding
GO:0036094	0.998	small molecule binding
GO:0043168	0.996	anion binding
GO:0033293	0.989	monocarboxylic acid binding
GO:0005515	0.965	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.924	biological regulation
GO:0050789	0.844	regulation of biological process
GO:0050794	0.828	regulation of cellular process
GO:0048519	0.592	negative regulation of biological process
GO:0009987	0.549	cellular process
GO:0071704	0.502	organic substance metabolic process
GO:0044238	0.498	primary metabolic process
GO:0042127	0.450	regulation of cell population proliferation
GO:0044237	0.408	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]