StarFunc result for job id P51168

User Input

>input (640 residues)
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFA
ALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELME
AVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSAS
EKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSY
PGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILD
IGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSP
CTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDF
PDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERD
QSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEF
GEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPN
TGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P37090	0.942	0.945	0.000	638	0.831	0.834	P37090.pdb.gz	SCNNB_RAT Amiloride-sensitive sodium channel subunit beta OS=Rattus norvegicus OX=10116 GN=Scnn1b PE=1 SV=2
2	AFDB:P51168	1.000	1.000	0.000	640	1.000	1.000	P51168.pdb.gz	SCNNB_HUMAN Amiloride-sensitive sodium channel subunit beta OS=Homo sapiens OX=9606 GN=SCNN1B PE=1 SV=2
3	AFDB:H1AFJ6	0.774	0.762	1.398E-81	651	0.539	0.530	H1AFJ6.pdb.gz	SCNNB_NEOFS Amiloride-sensitive sodium channel subunit beta OS=Neoceratodus forsteri OX=7892 GN=scnn1b PE=2 SV=1
4	PDB:6wthB	0.640	0.989	1.246E-75	413	0.645	1.000	6wthB.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
5	AFDB:Q9WU39	0.727	0.711	5.887E-63	655	0.361	0.353	Q9WU39.pdb.gz	SCNNG_MOUSE Amiloride-sensitive sodium channel subunit gamma OS=Mus musculus OX=10090 GN=Scnn1g PE=1 SV=1
6	AFDB:H1AFJ7	0.786	0.770	1.778E-62	653	0.347	0.340	H1AFJ7.pdb.gz	SCNNG_NEOFS Amiloride-sensitive sodium channel subunit gamma OS=Neoceratodus forsteri OX=7892 GN=scnn1g PE=2 SV=1
7	AFDB:A5X2V1	0.708	0.699	5.781E-61	649	0.355	0.350	A5X2V1.pdb.gz	A5X2V1_HUMAN Amiloride-sensitive sodium channel gamma-subunit OS=Homo sapiens OX=9606 GN=SCNN1G PE=2 SV=1
8	AFDB:H1AFJ5	0.769	0.752	1.426E-53	655	0.331	0.324	H1AFJ5.pdb.gz	SCNNA_NEOFS Amiloride-sensitive sodium channel subunit alpha OS=Neoceratodus forsteri OX=7892 GN=scnn1a PE=1 SV=1
9	AFDB:P37088	0.717	0.688	4.551E-53	669	0.309	0.296	P37088.pdb.gz	SCNNA_HUMAN Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1
10	AFDB:Q61180	0.736	0.677	3.928E-52	699	0.319	0.292	Q61180.pdb.gz	SCNNA_MOUSE Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2
11	AFDB:P51172	0.658	0.530	2.873E-48	802	0.259	0.207	P51172.pdb.gz	SCNND_HUMAN Amiloride-sensitive sodium channel subunit delta OS=Homo sapiens OX=9606 GN=SCNN1D PE=1 SV=3
12	PDB:6wthC	0.560	0.913	6.087E-43	389	0.244	0.401	6wthC.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
13	PDB:6wthA	0.534	0.879	9.652E-36	381	0.214	0.360	6wthA.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
14	PDB:6vtkA	0.534	0.740	2.132E-31	446	0.177	0.253	6vtkA.pdb.gz
15	PDB:7jncA	0.171	0.331	4.299E-2	287	0.047	0.105	7jncA.pdb.gz
16	PDB:7ocaA	0.055	0.046	8.983E-1	775	0.056	0.046	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
17	PDB:6lqsB1	0.059	0.051	1.184	806	0.020	0.016	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
18	PDB:3afkA	0.036	0.095	1.251	167	0.025	0.096	3afkA.pdb.gz	Structural insights into the recognition mechanism between an antitumor galectin AAL and the Thomsen-Friedenreich antigen
19	PDB:4pxdA	0.064	0.090	1.477	411	0.033	0.051	4pxdA.pdb.gz	Structural insights into the substrate specificity of (s)-ureidoglycolate amidohydrolase and its comparison with allantoate amidohydrolase.
20	PDB:5huxA	0.080	0.104	1.650	429	0.069	0.103	5huxA.pdb.gz	Crystal Structures of Putative Sugar Kinases from Synechococcus Elongatus PCC 7942 and Arabidopsis Thaliana

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H1AFJ6	0.0	752	651	0.550	0.541	SCNNB_NEOFS Amiloride-sensitive sodium channel subunit beta OS=Neoceratodus forsteri OX=7892 GN=scnn1b PE=2 SV=1
2	P37090	0.0	1133	638	0.834	0.837	SCNNB_RAT Amiloride-sensitive sodium channel subunit beta OS=Rattus norvegicus OX=10116 GN=Scnn1b PE=1 SV=2
3	P51168	0.0	1347	640	1.000	1.000	SCNNB_HUMAN Amiloride-sensitive sodium channel subunit beta OS=Homo sapiens OX=9606 GN=SCNN1B PE=1 SV=2
4	Q9WU38	0.0	1113	638	0.839	0.842	SCNNB_MOUSE Amiloride-sensitive sodium channel subunit beta OS=Mus musculus OX=10090 GN=Scnn1b PE=1 SV=1
5	Q9WU39	4.01e-139	422	655	0.369	0.360	SCNNG_MOUSE Amiloride-sensitive sodium channel subunit gamma OS=Mus musculus OX=10090 GN=Scnn1g PE=1 SV=1
6	P37091	2.61e-138	420	650	0.369	0.363	SCNNG_RAT Amiloride-sensitive sodium channel subunit gamma OS=Rattus norvegicus OX=10116 GN=Scnn1g PE=1 SV=2
7	A5X2V1	4.49e-138	419	649	0.356	0.351	A5X2V1_HUMAN Amiloride-sensitive sodium channel gamma-subunit OS=Homo sapiens OX=9606 GN=SCNN1G PE=2 SV=1
8	P51170	4.49e-138	419	649	0.356	0.351	SCNNG_HUMAN Amiloride-sensitive sodium channel subunit gamma OS=Homo sapiens OX=9606 GN=SCNN1G PE=1 SV=4
9	H1AFJ7	4.87e-136	414	653	0.350	0.343	SCNNG_NEOFS Amiloride-sensitive sodium channel subunit gamma OS=Neoceratodus forsteri OX=7892 GN=scnn1g PE=2 SV=1
10	H1AFJ5	5.05e-121	375	655	0.331	0.324	SCNNA_NEOFS Amiloride-sensitive sodium channel subunit alpha OS=Neoceratodus forsteri OX=7892 GN=scnn1a PE=1 SV=1
11	Q61180	9.42e-109	345	699	0.286	0.262	SCNNA_MOUSE Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2
12	P37088	1.41e-108	343	669	0.303	0.290	SCNNA_HUMAN Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1
13	P37089	2.41e-108	344	698	0.284	0.261	SCNNA_RAT Amiloride-sensitive sodium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Scnn1a PE=1 SV=2
14	P51172	8.69e-83	279	802	0.239	0.191	SCNND_HUMAN Amiloride-sensitive sodium channel subunit delta OS=Homo sapiens OX=9606 GN=SCNN1D PE=1 SV=3
15	Q708S6	7.22e-42	161	529	0.234	0.284	ASI1C_DANRE Acid-sensing ion channel 1C OS=Danio rerio OX=7955 GN=asic1c PE=1 SV=1
16	Q21974	1.54e-41	163	777	0.167	0.138	UNC8_CAEEL Degenerin unc-8 OS=Caenorhabditis elegans OX=6239 GN=unc-8 PE=2 SV=1
17	Q16515	1.01e-39	154	512	0.153	0.191	ASIC2_HUMAN Acid-sensing ion channel 2 OS=Homo sapiens OX=9606 GN=ASIC2 PE=1 SV=1
18	Q925H0	1.26e-39	154	512	0.153	0.191	ASIC2_MOUSE Acid-sensing ion channel 2 OS=Mus musculus OX=10090 GN=Asic2 PE=1 SV=1
19	Q62962	2.08e-39	154	512	0.153	0.191	ASIC2_RAT Acid-sensing ion channel 2 OS=Rattus norvegicus OX=10116 GN=Asic2 PE=1 SV=1
20	Q1XA76	3.16e-39	153	527	0.208	0.252	ASIC1_CHICK Acid-sensing ion channel 1 OS=Gallus gallus OX=9031 GN=ASIC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00858 ASC	9.4e-110	379.3	Amiloride-sensitive sodium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345751

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383199	0.998	E3 ubiquitin-protein ligase NEDD4-like
2	9606.ENSP00000353292	0.997	Amiloride-sensitive sodium channel subunit alpha
3	9606.ENSP00000300061	0.996	Amiloride-sensitive sodium channel subunit gamma
4	9606.ENSP00000424827	0.989	E3 ubiquitin-protein ligase NEDD4
5	9606.ENSP00000356832	0.972	Serine/threonine-protein kinase Sgk1
6	9606.ENSP00000246914	0.951	Serine/threonine-protein kinase WNK4
7	9606.ENSP00000341292	0.946	Serine/threonine-protein kinase WNK1
8	9606.ENSP00000346667	0.941	Serine/threonine-protein kinase WNK3
9	9606.ENSP00000361458	0.936	TSC22 domain family protein 3
10	9606.ENSP00000251849	0.931	RAF proto-oncogene serine/threonine-protein kinase
11	9606.ENSP00000427793	0.923	NEDD4-like E3 ubiquitin-protein ligase WWP1
12	9606.ENSP00000340608	0.914	Serine/threonine-protein kinase Sgk2
13	9606.ENSP00000304697	0.912	Polyubiquitin-B
14	9606.ENSP00000441543	0.911	Polyubiquitin-C
15	9606.ENSP00000322460	0.907	Sodium channel subunit beta-4
16	9606.ENSP00000272317	0.902	Ubiquitin-40S ribosomal protein S27a
17	9606.ENSP00000396320	0.902	Sodium channel protein type 4 subunit alpha
18	9606.ENSP00000297954	0.900	Serine/threonine-protein kinase WNK2
19	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
20	9606.ENSP00000396915	0.900	Sodium channel subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050699	1.000	WW domain binding
GO:0015280	1.000	ligand-gated sodium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0042592	0.996	homeostatic process
GO:0030001	0.995	metal ion transport
GO:0035725	0.991	sodium ion transmembrane transport
GO:0055078	0.989	sodium ion homeostasis
GO:0099587	0.989	inorganic ion import across plasma membrane
GO:0065007	0.986	biological regulation
GO:0032501	0.983	multicellular organismal process
GO:0010033	0.957	response to organic substance
GO:0098659	0.949	inorganic cation import across plasma membrane
GO:0065008	0.912	regulation of biological quality
GO:1902075	0.907	cellular response to salt
GO:1901698	0.869	response to nitrogen compound
GO:0019725	0.856	cellular homeostasis
GO:0055082	0.837	intracellular chemical homeostasis
GO:0006873	0.814	intracellular monoatomic ion homeostasis
GO:0050878	0.807	regulation of body fluid levels
GO:0050891	0.768	multicellular organismal-level water homeostasis
GO:0071310	0.753	cellular response to organic substance
GO:0014070	0.738	response to organic cyclic compound
GO:0009719	0.698	response to endogenous stimulus
GO:0071407	0.675	cellular response to organic cyclic compound
GO:0071495	0.646	cellular response to endogenous stimulus
GO:0030003	0.644	intracellular monoatomic cation homeostasis
GO:0071417	0.615	cellular response to organonitrogen compound
GO:0050789	0.560	regulation of biological process
GO:0009628	0.540	response to abiotic stimulus
GO:0006883	0.338	intracellular sodium ion homeostasis
GO:0050794	0.324	regulation of cellular process
GO:0003008	0.305	system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0034706	0.998	sodium channel complex
GO:0043227	0.969	membrane-bounded organelle
GO:0005576	0.934	extracellular region
GO:0031982	0.882	vesicle
GO:1903561	0.874	extracellular vesicle
GO:0070062	0.858	extracellular exosome
GO:0005622	0.699	intracellular anatomical structure
GO:0005737	0.679	cytoplasm
GO:0070013	0.470	intracellular organelle lumen
GO:0043231	0.464	intracellular membrane-bounded organelle
GO:0009986	0.324	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]