StarFunc result for job id P51170

User Input

>input (649 residues)
MAPGEKIKAKIKKNLPVTGPQAPTIKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFT
LTAVALILWQCALLVFSFYTVSVSIKVHFRKLDFPAVTICNINPYKYSTVRHLLADLEQE
TREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKR
KVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQ
VPLEKKINMSYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTFNNRENETILSTSMG
GSEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLT
ESFKLSEPYSQCTEDGSDVPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLPPAA
NYCNYQQHPNWMYCYYQLHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQWPSVVSEKWL
LPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMS
CSVVCVIEIIEVFFIDFFSIIARRQWQKAKEWWAWKQAPPCPEAPRSPQGQDNPALDIDD
DLPTFNSALHLPPALGTQVPGTPPPKYNTLRLERAFSNQLTDTQMLDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5X2V1	0.802	0.802	0.000	649	1.000	1.000	A5X2V1.pdb.gz	A5X2V1_HUMAN Amiloride-sensitive sodium channel gamma-subunit OS=Homo sapiens OX=9606 GN=SCNN1G PE=2 SV=1
2	AFDB:Q9WU39	0.864	0.856	0.000	655	0.863	0.855	Q9WU39.pdb.gz	SCNNG_MOUSE Amiloride-sensitive sodium channel subunit gamma OS=Mus musculus OX=10090 GN=Scnn1g PE=1 SV=1
3	AFDB:H1AFJ7	0.796	0.791	6.953E-84	653	0.518	0.515	H1AFJ7.pdb.gz	SCNNG_NEOFS Amiloride-sensitive sodium channel subunit gamma OS=Neoceratodus forsteri OX=7892 GN=scnn1g PE=2 SV=1
4	PDB:6wthC	0.584	0.966	1.189E-65	389	0.596	0.995	6wthC.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
5	AFDB:H1AFJ6	0.727	0.724	6.303E-65	651	0.371	0.370	H1AFJ6.pdb.gz	SCNNB_NEOFS Amiloride-sensitive sodium channel subunit beta OS=Neoceratodus forsteri OX=7892 GN=scnn1b PE=2 SV=1
6	AFDB:P51168	0.749	0.758	5.697E-63	640	0.347	0.352	P51168.pdb.gz	SCNNB_HUMAN Amiloride-sensitive sodium channel subunit beta OS=Homo sapiens OX=9606 GN=SCNN1B PE=1 SV=2
7	AFDB:P37090	0.732	0.744	4.459E-62	638	0.350	0.356	P37090.pdb.gz	SCNNB_RAT Amiloride-sensitive sodium channel subunit beta OS=Rattus norvegicus OX=10116 GN=Scnn1b PE=1 SV=2
8	AFDB:H1AFJ5	0.744	0.738	8.016E-56	655	0.317	0.315	H1AFJ5.pdb.gz	SCNNA_NEOFS Amiloride-sensitive sodium channel subunit alpha OS=Neoceratodus forsteri OX=7892 GN=scnn1a PE=1 SV=1
9	AFDB:P37088	0.685	0.667	5.309E-55	669	0.316	0.306	P37088.pdb.gz	SCNNA_HUMAN Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1
10	AFDB:Q61180	0.678	0.633	7.011E-55	699	0.327	0.303	Q61180.pdb.gz	SCNNA_MOUSE Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2
11	AFDB:P51172	0.651	0.533	3.589E-50	802	0.277	0.224	P51172.pdb.gz	SCNND_HUMAN Amiloride-sensitive sodium channel subunit delta OS=Homo sapiens OX=9606 GN=SCNN1D PE=1 SV=3
12	PDB:6wthB	0.589	0.914	1.590E-46	413	0.243	0.383	6wthB.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
13	PDB:6wthA	0.541	0.903	2.955E-39	381	0.236	0.402	6wthA.pdb.gz	Molecular principles of assembly, activation, and inhibition in epithelial sodium channel.
14	PDB:6vtkA	0.531	0.750	1.783E-29	446	0.173	0.251	6vtkA.pdb.gz
15	PDB:7jncA	0.169	0.334	1.683E-2	287	0.054	0.122	7jncA.pdb.gz
16	PDB:1c7yA	0.077	0.181	9.223E-1	199	0.022	0.070	1c7yA.pdb.gz	Crystal structure of the holliday junction DNA in complex with a single RuvA tetramer.
17	PDB:4dayB	0.082	0.254	9.223E-1	113	0.014	0.080	4dayB.pdb.gz	Defining the molecular interface that connects the Fanconi anemia protein FANCM to the Bloom syndrome dissolvasome.
18	PDB:5dhmC	0.057	0.100	1.521	268	0.029	0.071	5dhmC.pdb.gz	Structure of the fimbrial protein Mfa4 from Porphyromonas gingivalis in its precursor form: implications for a donor-strand complementation mechanism.
19	PDB:4uykA	0.061	0.291	3.503	82	0.014	0.110	4uykA.pdb.gz	Crystal Structure of a Signal Recognition Particle Alu Domain in the Elongation Arrest Conformation.
20	PDB:2nz2A	0.036	0.054	3.915	402	0.014	0.022	2nz2A.pdb.gz	Structure of human argininosuccinate synthetase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5X2V1	0.0	1365	649	1.000	1.000	A5X2V1_HUMAN Amiloride-sensitive sodium channel gamma-subunit OS=Homo sapiens OX=9606 GN=SCNN1G PE=2 SV=1
2	H1AFJ7	0.0	715	653	0.521	0.518	SCNNG_NEOFS Amiloride-sensitive sodium channel subunit gamma OS=Neoceratodus forsteri OX=7892 GN=scnn1g PE=2 SV=1
3	P37091	0.0	1196	650	0.867	0.866	SCNNG_RAT Amiloride-sensitive sodium channel subunit gamma OS=Rattus norvegicus OX=10116 GN=Scnn1g PE=1 SV=2
4	P51170	0.0	1365	649	1.000	1.000	SCNNG_HUMAN Amiloride-sensitive sodium channel subunit gamma OS=Homo sapiens OX=9606 GN=SCNN1G PE=1 SV=4
5	Q9WU39	0.0	1182	655	0.863	0.855	SCNNG_MOUSE Amiloride-sensitive sodium channel subunit gamma OS=Mus musculus OX=10090 GN=Scnn1g PE=1 SV=1
6	H1AFJ6	1.50e-144	436	651	0.378	0.376	SCNNB_NEOFS Amiloride-sensitive sodium channel subunit beta OS=Neoceratodus forsteri OX=7892 GN=scnn1b PE=2 SV=1
7	P51168	7.58e-135	411	640	0.351	0.356	SCNNB_HUMAN Amiloride-sensitive sodium channel subunit beta OS=Homo sapiens OX=9606 GN=SCNN1B PE=1 SV=2
8	P37090	7.33e-133	406	638	0.347	0.353	SCNNB_RAT Amiloride-sensitive sodium channel subunit beta OS=Rattus norvegicus OX=10116 GN=Scnn1b PE=1 SV=2
9	Q9WU38	4.22e-130	399	638	0.339	0.345	SCNNB_MOUSE Amiloride-sensitive sodium channel subunit beta OS=Mus musculus OX=10090 GN=Scnn1b PE=1 SV=1
10	H1AFJ5	1.50e-127	393	655	0.344	0.340	SCNNA_NEOFS Amiloride-sensitive sodium channel subunit alpha OS=Neoceratodus forsteri OX=7892 GN=scnn1a PE=1 SV=1
11	P37089	5.66e-124	385	698	0.300	0.279	SCNNA_RAT Amiloride-sensitive sodium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Scnn1a PE=1 SV=2
12	P37088	8.20e-123	381	669	0.304	0.294	SCNNA_HUMAN Amiloride-sensitive sodium channel subunit alpha OS=Homo sapiens OX=9606 GN=SCNN1A PE=1 SV=1
13	Q61180	8.10e-121	377	699	0.296	0.275	SCNNA_MOUSE Amiloride-sensitive sodium channel subunit alpha OS=Mus musculus OX=10090 GN=Scnn1a PE=1 SV=2
14	P51172	5.96e-91	301	802	0.277	0.224	SCNND_HUMAN Amiloride-sensitive sodium channel subunit delta OS=Homo sapiens OX=9606 GN=SCNN1D PE=1 SV=3
15	Q21974	2.10e-39	157	777	0.160	0.134	UNC8_CAEEL Degenerin unc-8 OS=Caenorhabditis elegans OX=6239 GN=unc-8 PE=2 SV=1
16	Q09274	5.19e-38	153	887	0.163	0.120	UN105_CAEEL Degenerin-like protein unc-105 OS=Caenorhabditis elegans OX=6239 GN=unc-105 PE=1 SV=3
17	P24612	4.50e-37	150	768	0.165	0.139	MEC4_CAEEL Degenerin mec-4 OS=Caenorhabditis elegans OX=6239 GN=mec-4 PE=1 SV=3
18	P34886	7.76e-37	149	724	0.154	0.138	MEC10_CAEEL Degenerin mec-10 OS=Caenorhabditis elegans OX=6239 GN=mec-10 PE=1 SV=1
19	P24585	1.17e-35	145	778	0.151	0.126	DEG1_CAEEL Degenerin deg-1 OS=Caenorhabditis elegans OX=6239 GN=deg-1 PE=1 SV=2
20	O01635	1.31e-35	145	823	0.142	0.112	ASIC1_CAEEL Degenerin-like protein asic-1 OS=Caenorhabditis elegans OX=6239 GN=asic-1 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00858 ASC	3.1e-105	364.4	Amiloride-sensitive sodium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300061

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353292	0.997	Amiloride-sensitive sodium channel subunit alpha
2	9606.ENSP00000345751	0.996	Amiloride-sensitive sodium channel subunit beta
3	9606.ENSP00000383199	0.996	E3 ubiquitin-protein ligase NEDD4-like
4	9606.ENSP00000424827	0.983	E3 ubiquitin-protein ligase NEDD4
5	9606.ENSP00000356832	0.974	Serine/threonine-protein kinase Sgk1
6	9606.ENSP00000246914	0.970	Serine/threonine-protein kinase WNK4
7	9606.ENSP00000341292	0.960	Serine/threonine-protein kinase WNK1
8	9606.ENSP00000346667	0.941	Serine/threonine-protein kinase WNK3
9	9606.ENSP00000361458	0.922	TSC22 domain family protein 3
10	9606.ENSP00000427793	0.920	NEDD4-like E3 ubiquitin-protein ligase WWP1
11	9606.ENSP00000304697	0.914	Polyubiquitin-B
12	9606.ENSP00000441543	0.914	Polyubiquitin-C
13	9606.ENSP00000297954	0.912	Serine/threonine-protein kinase WNK2
14	9606.ENSP00000340608	0.910	Serine/threonine-protein kinase Sgk2
15	9606.ENSP00000322460	0.905	Sodium channel subunit beta-4
16	9606.ENSP00000251849	0.902	RAF proto-oncogene serine/threonine-protein kinase
17	9606.ENSP00000272317	0.902	Ubiquitin-40S ribosomal protein S27a
18	9606.ENSP00000396320	0.902	Sodium channel protein type 4 subunit alpha
19	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
20	9606.ENSP00000396915	0.900	Sodium channel subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050699	1.000	WW domain binding
GO:0015280	1.000	ligand-gated sodium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0055078	0.995	sodium ion homeostasis
GO:0030001	0.995	metal ion transport
GO:0098659	0.992	inorganic cation import across plasma membrane
GO:0035725	0.990	sodium ion transmembrane transport
GO:1901698	0.987	response to nitrogen compound
GO:0009719	0.985	response to endogenous stimulus
GO:0010033	0.965	response to organic substance
GO:0065007	0.916	biological regulation
GO:1902075	0.889	cellular response to salt
GO:0071495	0.842	cellular response to endogenous stimulus
GO:0071310	0.836	cellular response to organic substance
GO:0006873	0.815	intracellular monoatomic ion homeostasis
GO:0014070	0.788	response to organic cyclic compound
GO:0032501	0.771	multicellular organismal process
GO:0071407	0.770	cellular response to organic cyclic compound
GO:1901699	0.758	cellular response to nitrogen compound
GO:0030003	0.737	intracellular monoatomic cation homeostasis
GO:0010243	0.721	response to organonitrogen compound
GO:0071417	0.692	cellular response to organonitrogen compound
GO:0065008	0.635	regulation of biological quality
GO:0050789	0.376	regulation of biological process
GO:0006883	0.376	intracellular sodium ion homeostasis
GO:0050794	0.328	regulation of cellular process
GO:0050878	0.300	regulation of body fluid levels

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0043227	0.995	membrane-bounded organelle
GO:0005654	0.988	nucleoplasm
GO:1902495	0.983	transmembrane transporter complex
GO:0034703	0.955	cation channel complex
GO:0034706	0.934	sodium channel complex
GO:0005737	0.916	cytoplasm
GO:0005576	0.869	extracellular region
GO:0031982	0.828	vesicle
GO:1903561	0.810	extracellular vesicle
GO:0070062	0.797	extracellular exosome
GO:0005829	0.399	cytosol
GO:0012505	0.377	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]