StarFunc result for job id P51178

User Input

>input (756 residues)
MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIVFKDQRNTLDLIAPSPADAQH
WVLGLHKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFRECDHSQTDSLEDEEIEAFYKMLTQRVEIDRTFAEAAGSGETLSVDQLVTFLQHQ
QREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFSLAHRRVYQDMGQ
PLSHYLVSSSHNTYLLEDQLAGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVLRAIRDYAFKASPYPVILSLENHCTLEQQRVMARHLHAILGPMLLNRPLDG
VTNSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVVSDEDEAAEMEDEAVRSRVQHK
PKEDKLRLAQELSDMVIYCKSVHFGGFSSPGTPGQAFYEMASFSENRALRLLQESGNGFV
RHNVGHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGPEMDVYQGRFQDNGACG
YVLKPAFLRDPNGTFNPRALAQGPWWARKRLNIRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVITNNGFNPWWDTEFAFEVVVPDLALIRFLVEDYDASSKNDFIGQST
IPLNSLKQGYRHVHLMSKNGDQHPSATLFVKISLQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P10688	0.993	0.993	0.000	756	0.911	0.911	P10688.pdb.gz	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
2	AFDB:F1Q5G9	0.919	0.913	2.830E-98	761	0.516	0.512	F1Q5G9.pdb.gz	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
3	AFDB:Q8K2J0	0.918	0.885	4.507E-96	785	0.503	0.484	Q8K2J0.pdb.gz	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
4	AFDB:D4A978	0.923	0.887	8.107E-96	788	0.503	0.482	D4A978.pdb.gz	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2
5	AFDB:F1QJ13	0.918	0.903	6.500E-95	769	0.467	0.459	F1QJ13.pdb.gz	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
6	AFDB:Q8N3E9	0.918	0.880	1.169E-94	789	0.501	0.480	Q8N3E9.pdb.gz	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
7	AFDB:Q9BRC7	0.899	0.892	7.178E-94	762	0.475	0.471	Q9BRC7.pdb.gz	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
8	AFDB:C9JEA7	0.880	0.839	8.887E-94	794	0.471	0.448	C9JEA7.pdb.gz	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
9	AFDB:Q8K3R3	0.882	0.828	8.299E-92	807	0.442	0.414	Q8K3R3.pdb.gz	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2
10	AFDB:Q62711	0.905	0.886	7.019E-91	772	0.430	0.421	Q62711.pdb.gz	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
11	PDB:4gnkB	0.740	0.729	1.066E-57	769	0.315	0.309	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:1cjyA	0.148	0.176	4.746E-7	633	0.030	0.036	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5ixcA	0.142	0.157	1.057E-6	684	0.028	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5iz5A	0.139	0.139	1.709E-6	757	0.028	0.028	5iz5A.pdb.gz
15	PDB:5iz5B	0.149	0.151	1.709E-6	746	0.030	0.031	5iz5B.pdb.gz
16	PDB:5a50A	0.138	0.571	3.074E-6	165	0.034	0.158	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:3nsjA	0.136	0.189	3.420E-6	530	0.037	0.053	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
18	PDB:5a52A	0.135	0.592	3.420E-6	154	0.038	0.188	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
19	PDB:5izrC	0.138	0.158	4.466E-6	659	0.028	0.032	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
20	PDB:4rj9A	0.138	0.584	7.616E-6	161	0.034	0.161	4rj9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AGE0	0.0	764	744	0.504	0.512	A0A8I6AGE0_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=4 SV=1
2	C9JEA7	0.0	675	794	0.471	0.448	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
3	D4A978	0.0	690	762	0.475	0.471	D4A978_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=1 SV=2
4	F1Q5G9	0.0	751	761	0.515	0.511	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
5	F1QJ13	0.0	680	769	0.467	0.459	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
6	P10688	0.0	1411	756	0.913	0.913	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
7	P51178	0.0	1581	756	1.000	1.000	PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2
8	Q62711	0.0	653	772	0.438	0.429	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
9	Q8K2J0	0.0	768	785	0.507	0.488	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
10	Q8N3E9	0.0	761	789	0.505	0.484	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
11	Q8R3B1	0.0	1380	756	0.909	0.909	PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus OX=10090 GN=Plcd1 PE=1 SV=2
12	Q9BRC7	0.0	689	762	0.472	0.469	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
13	Q8K394	9.95e-164	504	1128	0.386	0.259	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
14	Q9UPR0	1.08e-161	499	1127	0.381	0.256	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
15	Q86YW0	1.01e-155	468	608	0.335	0.416	PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens OX=9606 GN=PLCZ1 PE=1 SV=1
16	Q15111	3.93e-154	478	1095	0.381	0.263	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3
17	Q8K4D7	9.38e-152	459	647	0.337	0.394	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
18	Q3USB7	1.02e-149	467	1096	0.373	0.257	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
19	Q5FX52	1.16e-149	453	645	0.340	0.398	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
20	Q62688	1.92e-149	466	1096	0.373	0.257	PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus OX=10116 GN=Plcl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	5.2e-14	63.7	C2 domain
2	PF00036 EF-hand_1	0.28	21.9	EF hand
3	PF14788 EF-hand_10	5.2e-23	92.1	EF hand
4	PF13202 EF-hand_5	42	15.0	EF hand
5	PF13405 EF-hand_6	0.03	25.2	EF-hand domain
6	PF13499 EF-hand_7	0.026	26.3	EF-hand domain pair
7	PF09279 EF-hand_like	1.8e-33	126.2	Phosphoinositide-specific phospholipase C, efhand-like
8	PF00169 PH	0.03	26.2	PH domain
9	PF16457 PH_12	0.014	27.3	Pleckstrin homology domain
10	PF00388 PI-PLC-X	8e-59	208.8	Phosphatidylinositol-specific phospholipase C, X domain
11	PF00387 PI-PLC-Y	6.9e-38	140.9	Phosphatidylinositol-specific phospholipase C, Y domain
12	PF05386 TEP1_N	4.8e+02	11.8	TEP1 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000015676

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000002495	0.985	Phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
2	9601.ENSPPYP00000005349	0.985	May play an important role in the production of Phosphatidylinositol bisphosphate (PIP2), in the endoplasmic reticulum.
3	9601.ENSPPYP00000021584	0.985	Phosphatidylinositol-4-phosphate 5-kinase, type I, beta
4	9601.ENSPPYP00000023589	0.985	Phosphatidylinositol-5-phosphate 4-kinase, type II, beta
5	9601.ENSPPYP00000022007	0.968	Phosphatidylinositol-4-phosphate 5-kinase-like 1
6	9601.ENSPPYP00000001019	0.962	Phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
7	9601.ENSPPYP00000018135	0.962	Uncharacterized protein
8	9601.ENSPPYP00000010524	0.960	Phosphatidylinositol-4-phosphate 5-kinase, type I, gamma
9	9601.ENSPPYP00000009342	0.918	Phospholipase C, delta 3
10	9601.ENSPPYP00000012298	0.876	Mediates the production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). Plays an important role in the regulation of intracellular signaling cascades.
11	9601.ENSPPYP00000008564	0.858	Phospholipase C, gamma 2 (phosphatidylinositol-specific)
12	9601.ENSPPYP00000015317	0.846	Inositol 1,4,5-trisphosphate receptor, type 1
13	9601.ENSPPYP00000002895	0.844	Phospholipase C, epsilon 1
14	9601.ENSPPYP00000004992	0.843	Inositol 1,4,5-trisphosphate receptor, type 2
15	9601.ENSPPYP00000018459	0.843	Inositol 1,4,5-trisphosphate receptor, type 3
16	9601.ENSPPYP00000012278	0.838	Transglutaminase 2
17	9601.ENSPPYP00000020587	0.834	DLC1 Rho GTPase activating protein
18	9601.ENSPPYP00000008139	0.822	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
19	9601.ENSPPYP00000011609	0.822	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
20	9601.ENSPPYP00000014724	0.808	Hydrolyzes the phosphatidylinositol 4,5-bisphosphate (PIP2) to generate 2 second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3). DAG mediates the activation of protein kinase C (PKC), while IP3 releases Ca(2+) from intracellular stores. Required for acrosome reaction in sperm during fertilization, probably by acting as an important enzyme for intracellular Ca(2+) mobilization in the zona pellucida-induced acrosome reaction. May play a role in cell growth. Modulates the liver regeneration in cooperation with nuclear PKC. Overexpression up-regulates the E [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0004629	0.997	phospholipase C activity
GO:0008289	0.996	lipid binding
GO:0043168	0.996	anion binding
GO:0004435	0.989	phosphatidylinositol phospholipase C activity
GO:0005546	0.987	phosphatidylinositol-4,5-bisphosphate binding
GO:0030695	0.438	GTPase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0044237	0.982	cellular metabolic process
GO:0046486	0.967	glycerolipid metabolic process
GO:0006793	0.957	phosphorus metabolic process
GO:0019637	0.933	organophosphate metabolic process
GO:0006796	0.920	phosphate-containing compound metabolic process
GO:0006644	0.899	phospholipid metabolic process
GO:0032501	0.837	multicellular organismal process
GO:0006650	0.820	glycerophospholipid metabolic process
GO:0046488	0.803	phosphatidylinositol metabolic process
GO:0050896	0.792	response to stimulus
GO:0001701	0.663	in utero embryonic development
GO:0001892	0.647	embryonic placenta development
GO:0072359	0.562	circulatory system development
GO:0023052	0.544	signaling
GO:0007154	0.544	cell communication
GO:0051716	0.539	cellular response to stimulus
GO:0001944	0.526	vasculature development
GO:0007165	0.518	signal transduction
GO:0048518	0.457	positive regulation of biological process
GO:0019222	0.396	regulation of metabolic process
GO:0048522	0.371	positive regulation of cellular process
GO:0035295	0.360	tube development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.993	membrane
GO:0005829	0.975	cytosol
GO:0043226	0.943	organelle
GO:0043227	0.915	membrane-bounded organelle
GO:0043229	0.899	intracellular organelle
GO:0005886	0.858	plasma membrane
GO:0043231	0.829	intracellular membrane-bounded organelle
GO:0031982	0.619	vesicle
GO:0005576	0.341	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	0.997	Phosphoric diester hydrolases.
RHEA:33179	0.989	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.989	phosphoinositide phospholipase C.

[back to server]