StarFunc result for job id P51397

User Input

>input (102 residues)
MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFIS
GVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51397	1.000	1.000	7.113E-17	102	1.000	1.000	P51397.pdb.gz	DAP1_HUMAN Death-associated protein 1 OS=Homo sapiens OX=9606 GN=DAP PE=1 SV=3
2	AFDB:Q10410	0.204	0.055	3.878	510	0.127	0.025	Q10410.pdb.gz	YD85_SCHPO Probable ADP-ribosylation factor-binding protein C1F3.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F3.05 PE=3 SV=1
3	AFDB:H3BP13	0.154	0.085	7.846	241	0.118	0.050	H3BP13.pdb.gz	H3BP13_HUMAN Trafficking protein particle complex subunit 2-like protein OS=Homo sapiens OX=9606 GN=TRAPPC2L PE=1 SV=1
4	AFDB:Q9SMP0	0.181	0.098	7.846	234	0.108	0.047	Q9SMP0.pdb.gz	NFYC1_ARATH Nuclear transcription factor Y subunit C-1 OS=Arabidopsis thaliana OX=3702 GN=NFYC1 PE=1 SV=1
5	PDB:7w59R	0.130	0.073	9.515	280	0.147	0.054	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51397	3.27e-69	203	102	1.000	1.000	DAP1_HUMAN Death-associated protein 1 OS=Homo sapiens OX=9606 GN=DAP PE=1 SV=3
2	A0PJW8	3.00e-07	47.0	107	0.363	0.346	DAPL1_HUMAN Death-associated protein-like 1 OS=Homo sapiens OX=9606 GN=DAPL1 PE=1 SV=2
3	Q4QQS1	1.0	30.4	425	0.176	0.042	T184A_RAT Transmembrane protein 184A OS=Rattus norvegicus OX=10116 GN=Tmem184a PE=1 SV=1
4	Q9VM62	2.9	28.9	1127	0.235	0.021	Q9VM62_DROME LD34181p OS=Drosophila melanogaster OX=7227 GN=SA1 PE=1 SV=2
5	E5L8C9	5.4	28.1	589	0.186	0.032	E5L8C9_CHICK Estrogen receptor OS=Gallus gallus OX=9031 PE=2 SV=1
6	Q9XIF7	5.9	28.1	300	0.216	0.073	Q9XIF7_ARATH Actin cross-linking protein (DUF569) OS=Arabidopsis thaliana OX=3702 GN=At1g59710 PE=1 SV=1
7	P06212	6.6	28.1	589	0.186	0.032	ESR1_CHICK Estrogen receptor OS=Gallus gallus OX=9031 GN=ESR1 PE=2 SV=1
8	H0ZLY1	8.1	27.7	621	0.147	0.024	H0ZLY1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=3 SV=2
9	Q91250	8.6	27.7	587	0.147	0.026	ESR1_TAEGU Estrogen receptor OS=Taeniopygia guttata OX=59729 GN=ESR1 PE=2 SV=1
10	A0A096SRM5	8.7	27.7	475	0.147	0.032	708A6_MAIZE UDP-glycosyltransferase 708A6 OS=Zea mays OX=4577 GN=UGT708A6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06615 Circovir2_Orf1	7.2e+02	11.7	Circovirus 2, Orf1
2	PF15228 DAP	1.9e-31	120.2	Death-associated protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_003932543.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003938448.1	0.785	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 312 ESTs, 3 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
2	27679.XP_010347438.1	0.636	Dual specificity protein phosphatase 18
3	27679.XP_003934280.2	0.534	28 kDa heat- and acid-stable phosphoprotein
4	27679.XP_003942690.2	0.529	Stromal cell-derived factor 2-like protein 1
5	27679.XP_010337836.1	0.510	Small EDRK-rich factor 2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	1.000	protein domain specific binding
GO:0070513	0.982	death domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0031326	0.973	regulation of cellular biosynthetic process
GO:0007154	0.972	cell communication
GO:0010556	0.972	regulation of macromolecule biosynthetic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0080090	0.970	regulation of primary metabolic process
GO:0048523	0.960	negative regulation of cellular process
GO:0007165	0.959	signal transduction
GO:0051246	0.956	regulation of protein metabolic process
GO:0009894	0.952	regulation of catabolic process
GO:0051247	0.949	positive regulation of protein metabolic process
GO:0006950	0.945	response to stress
GO:0050790	0.945	regulation of catalytic activity
GO:0043085	0.944	positive regulation of catalytic activity
GO:0009605	0.927	response to external stimulus
GO:0031329	0.923	regulation of cellular catabolic process
GO:0010468	0.916	regulation of gene expression
GO:0031324	0.916	negative regulation of cellular metabolic process
GO:0051336	0.913	regulation of hydrolase activity
GO:0052548	0.896	regulation of endopeptidase activity
GO:0051345	0.891	positive regulation of hydrolase activity
GO:0033554	0.882	cellular response to stress
GO:0019219	0.856	regulation of nucleobase-containing compound metabolic process
GO:0043281	0.855	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051252	0.850	regulation of RNA metabolic process
GO:0051172	0.840	negative regulation of nitrogen compound metabolic process
GO:0009991	0.821	response to extracellular stimulus
GO:0006355	0.821	regulation of DNA-templated transcription
GO:2001056	0.815	positive regulation of cysteine-type endopeptidase activity
GO:0043280	0.808	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0008219	0.791	cell death
GO:0042594	0.783	response to starvation
GO:0010605	0.783	negative regulation of macromolecule metabolic process
GO:0031668	0.778	cellular response to extracellular stimulus
GO:0031669	0.753	cellular response to nutrient levels
GO:0044092	0.747	negative regulation of molecular function
GO:1990928	0.746	response to amino acid starvation
GO:0009895	0.729	negative regulation of catabolic process
GO:0009267	0.698	cellular response to starvation
GO:0010506	0.649	regulation of autophagy
GO:0051090	0.641	regulation of DNA-binding transcription factor activity
GO:0032088	0.617	negative regulation of NF-kappaB transcription factor activity
GO:0006919	0.617	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045934	0.570	negative regulation of nucleobase-containing compound metabolic process
GO:0034198	0.532	cellular response to amino acid starvation
GO:0031330	0.483	negative regulation of cellular catabolic process
GO:0097190	0.423	apoptotic signaling pathway
GO:0010558	0.384	negative regulation of macromolecule biosynthetic process
GO:0031327	0.381	negative regulation of cellular biosynthetic process
GO:0008152	0.376	metabolic process
GO:0048522	0.301	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005634	0.997	nucleus
GO:0005829	0.992	cytosol
GO:0016020	0.926	membrane
GO:0032991	0.871	protein-containing complex
GO:0031974	0.705	membrane-enclosed lumen
GO:0070013	0.704	intracellular organelle lumen
GO:0012505	0.640	endomembrane system
GO:0071944	0.616	cell periphery
GO:0005886	0.612	plasma membrane
GO:0031981	0.425	nuclear lumen
GO:0005654	0.410	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]