StarFunc result for job id P51449

User Input

>input (518 residues)
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQR
CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPG
LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF
SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHV
ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51449	1.000	1.000	3.120E-66	518	1.000	1.000	P51449.pdb.gz	RORG_HUMAN Nuclear receptor ROR-gamma OS=Homo sapiens OX=9606 GN=RORC PE=1 SV=2
2	AFDB:P51450	0.537	0.539	6.836E-59	516	0.886	0.890	P51450.pdb.gz	RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus OX=10090 GN=Rorc PE=1 SV=1
3	AFDB:F1QLY4	0.488	0.539	1.029E-39	468	0.483	0.534	F1QLY4.pdb.gz	RORAA_DANRE Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2
4	AFDB:P35398	0.505	0.500	4.433E-39	523	0.477	0.472	P35398.pdb.gz	RORA_HUMAN Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2
5	AFDB:A0A0C4DFP5	0.491	0.465	8.236E-39	548	0.471	0.445	A0A0C4DFP5.pdb.gz	A0A0C4DFP5_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
6	AFDB:P45446	0.491	0.540	4.227E-37	470	0.461	0.509	P45446.pdb.gz	RORB_RAT Nuclear receptor ROR-beta OS=Rattus norvegicus OX=10116 GN=Rorb PE=1 SV=3
7	AFDB:P31396	0.451	0.479	3.637E-27	487	0.330	0.351	P31396.pdb.gz	HR3_DROME Probable nuclear hormone receptor HR3 OS=Drosophila melanogaster OX=7227 GN=Hr3 PE=2 SV=1
8	AFDB:P41828	0.357	0.317	9.131E-22	588	0.280	0.247	P41828.pdb.gz	NHR23_CAEEL Nuclear hormone receptor family member nhr-23 OS=Caenorhabditis elegans OX=6239 GN=nhr-23 PE=1 SV=2
9	AFDB:Q3UV55	0.327	0.277	1.694E-20	615	0.278	0.234	Q3UV55.pdb.gz	NR1D1_MOUSE Nuclear receptor subfamily 1 group D member 1 OS=Mus musculus OX=10090 GN=Nr1d1 PE=1 SV=1
10	AFDB:B3DHW0	0.330	0.338	2.014E-18	504	0.292	0.300	B3DHW0.pdb.gz
11	PDB:3dzyA	0.348	0.571	1.876E-11	302	0.174	0.298	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.398	0.824	6.767E-11	238	0.125	0.273	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.249	0.500	4.116E-5	246	0.068	0.142	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.288	0.541	9.525E-4	259	0.069	0.139	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:7jvrR	0.090	0.142	2.404E-1	269	0.058	0.112	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
16	PDB:4alyA	0.092	0.176	4.879E-1	211	0.054	0.133	4alyA.pdb.gz
17	PDB:1rqiA	0.092	0.134	6.651E-1	300	0.066	0.113	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
18	PDB:1keyB	0.111	0.209	7.266E-1	221	0.056	0.131	1keyB.pdb.gz
19	PDB:7p5jA	0.063	0.078	8.673E-1	399	0.068	0.088	7p5jA.pdb.gz
20	PDB:3hajA	0.081	0.112	9.904E-1	286	0.056	0.101	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2QC01	0.0	855	487	0.828	0.881	A0A0G2QC01_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
2	A0A8I5ZN69	0.0	876	524	0.849	0.840	A0A8I5ZN69_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
3	A0A8I6GEH3	0.0	897	508	0.871	0.888	A0A8I6GEH3_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
4	F1D8P6	0.0	1025	497	0.954	0.994	F1D8P6_HUMAN RAR-related orphan nuclear receptor variant 2 OS=Homo sapiens OX=9606 GN=NR1F3 PE=2 SV=1
5	P51449	0.0	1071	518	1.000	1.000	RORG_HUMAN Nuclear receptor ROR-gamma OS=Homo sapiens OX=9606 GN=RORC PE=1 SV=2
6	P51450	0.0	924	516	0.886	0.890	RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus OX=10090 GN=Rorc PE=1 SV=1
7	Q6I9R9	0.0	1071	518	1.000	1.000	Q6I9R9_HUMAN RAR-related orphan receptor C OS=Homo sapiens OX=9606 GN=RORC PE=2 SV=1
8	A0A8I6A746	6.61e-162	464	339	0.469	0.717	A0A8I6A746_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
9	A0A8I6A803	5.94e-161	469	523	0.490	0.486	A0A8I6A803_RAT RAR-related orphan receptor A OS=Rattus norvegicus OX=10116 GN=Rora PE=3 SV=1
10	P51448	6.00e-161	469	523	0.490	0.486	RORA_MOUSE Nuclear receptor ROR-alpha OS=Mus musculus OX=10090 GN=Rora PE=1 SV=1
11	P35398	1.12e-160	468	523	0.490	0.486	RORA_HUMAN Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2
12	F1QLY4	1.41e-160	466	468	0.492	0.545	RORAA_DANRE Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2
13	F1LZZ3	1.80e-156	456	467	0.473	0.525	F1LZZ3_RAT RAR-related orphan receptor A OS=Rattus norvegicus OX=10116 GN=Rora PE=3 SV=3
14	A0A0C4DG53	3.53e-156	455	468	0.473	0.524	A0A0C4DG53_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
15	A0A0C4DFP5	2.07e-154	453	548	0.467	0.442	A0A0C4DFP5_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
16	Q8R1B8	7.21e-150	439	470	0.465	0.513	RORB_MOUSE Nuclear receptor ROR-beta OS=Mus musculus OX=10090 GN=Rorb PE=1 SV=3
17	Q92753	8.96e-150	439	470	0.467	0.515	RORB_HUMAN Nuclear receptor ROR-beta OS=Homo sapiens OX=9606 GN=RORB PE=1 SV=3
18	P45446	1.28e-148	436	470	0.465	0.513	RORB_RAT Nuclear receptor ROR-beta OS=Rattus norvegicus OX=10116 GN=Rorb PE=1 SV=3
19	B5DFL4	6.86e-99	297	161	0.280	0.901	B5DFL4_RAT Rorc protein OS=Rattus norvegicus OX=10116 GN=Rorc PE=2 SV=1
20	P31396	2.07e-80	261	487	0.351	0.374	HR3_DROME Probable nuclear hormone receptor HR3 OS=Drosophila melanogaster OX=7227 GN=Hr3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15504 DUF4647	73	13.9	Domain of unknown function (DUF4647)
2	PF00104 Hormone_recep	1.5e-10	52.6	Ligand-binding domain of nuclear hormone receptor
3	PF00787 PX	4.3e+02	13.0	PX domain
4	PF00105 zf-C4	2.1e-27	106.7	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264657	0.982	Signal transducer and activator of transcription 3
2	9606.ENSP00000365380	0.971	Forkhead box protein P3
3	9606.ENSP00000286639	0.968	Basic leucine zipper transcriptional factor ATF-like
4	9606.ENSP00000385216	0.954	Nuclear receptor coactivator 1
5	9606.ENSP00000384371	0.953	B-cell lymphoma 6 protein
6	9606.ENSP00000382800	0.937	Runt-related transcription factor 3
7	9606.ENSP00000437955	0.934	Hypoxia-inducible factor 1-alpha
8	9606.ENSP00000368880	0.930	Forkhead box protein O1
9	9606.ENSP00000306245	0.915	Proto-oncogene c-Fos
10	9606.ENSP00000385824	0.914	Forkhead box protein O3
11	9606.ENSP00000479618	0.913	Myc proto-oncogene protein
12	9606.ENSP00000303315	0.912	Transcription factor jun-B
13	9606.ENSP00000354487	0.908	Zinc finger E-box-binding homeobox 1
14	9606.ENSP00000386165	0.908	CCAAT/enhancer-binding protein delta
15	9606.ENSP00000261523	0.907	Nuclear receptor ROR-alpha
16	9606.ENSP00000356840	0.903	POU domain, class 2, transcription factor 1
17	9606.ENSP00000323588	0.901	Transcription factor SOX-2
18	9606.ENSP00000227507	0.900	G1/S-specific cyclin-D1
19	9606.ENSP00000229307	0.900	Homeobox protein NANOG
20	9606.ENSP00000242261	0.900	Twist-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0038023	0.998	signaling receptor activity
GO:0000987	0.997	cis-regulatory region sequence-specific DNA binding
GO:0098531	0.996	ligand-activated transcription factor activity
GO:0004879	0.990	nuclear receptor activity
GO:0008289	0.969	lipid binding
GO:0000978	0.967	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.849	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0005496	0.840	steroid binding
GO:0032934	0.811	sterol binding
GO:0008134	0.432	transcription factor binding
GO:0001221	0.301	transcription coregulator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0080090	0.969	regulation of primary metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0010468	0.969	regulation of gene expression
GO:0051171	0.967	regulation of nitrogen compound metabolic process
GO:0009889	0.936	regulation of biosynthetic process
GO:0009987	0.932	cellular process
GO:0006355	0.928	regulation of DNA-templated transcription
GO:0050896	0.922	response to stimulus
GO:0048518	0.842	positive regulation of biological process
GO:0051716	0.789	cellular response to stimulus
GO:0048519	0.760	negative regulation of biological process
GO:0048522	0.720	positive regulation of cellular process
GO:0007623	0.673	circadian rhythm
GO:0006357	0.673	regulation of transcription by RNA polymerase II
GO:0048523	0.659	negative regulation of cellular process
GO:0042221	0.644	response to chemical
GO:0070887	0.583	cellular response to chemical stimulus
GO:0009893	0.560	positive regulation of metabolic process
GO:0010604	0.538	positive regulation of macromolecule metabolic process
GO:0010605	0.431	negative regulation of macromolecule metabolic process
GO:0031325	0.402	positive regulation of cellular metabolic process
GO:0009890	0.401	negative regulation of biosynthetic process
GO:0051173	0.398	positive regulation of nitrogen compound metabolic process
GO:0051172	0.384	negative regulation of nitrogen compound metabolic process
GO:0031324	0.384	negative regulation of cellular metabolic process
GO:0010558	0.379	negative regulation of macromolecule biosynthetic process
GO:0031327	0.371	negative regulation of cellular biosynthetic process
GO:0071310	0.361	cellular response to organic substance
GO:0045892	0.351	negative regulation of DNA-templated transcription
GO:0009891	0.327	positive regulation of biosynthetic process
GO:0045935	0.323	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.315	positive regulation of cellular biosynthetic process
GO:1902680	0.311	positive regulation of RNA biosynthetic process
GO:0045893	0.303	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.922	nuclear body
GO:0005737	0.642	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]