StarFunc result for job id P51451

User Input

>input (505 residues)
MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDK
HFVVALYDYTAMNDRDLQMLKGEKLQVLKGTGDWWLARSLVTGREGYVPSNFVARVESLE
MERWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDVTTQGELIKHYKIR
CLDEGGYYISPRITFPSLQALVQHYSKKGDGLCQRLTLPCVRPAPQNPWAQDEWEIPRQS
LRLVRKLGSGQFGEVWMGYYKNNMKVAIKTLKEGTMSPEAFLGEANVMKALQHERLVRLY
AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIERMNSIHRD
LRAANILVSEALCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWS
FGVLLMEVVTYGRVPYPGMSNPEVIRNLERGYRMPRPDTCPPELYRGVIAECWRSRPEER
PTFEFLQSVLEDFYTATERQYELQP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51451	1.000	1.000	1.147E-98	505	1.000	1.000	P51451.pdb.gz	BLK_HUMAN Tyrosine-protein kinase Blk OS=Homo sapiens OX=9606 GN=BLK PE=1 SV=3
2	AFDB:P16277	0.934	0.945	4.912E-86	499	0.861	0.872	P16277.pdb.gz	BLK_MOUSE Tyrosine-protein kinase Blk OS=Mus musculus OX=10090 GN=Blk PE=1 SV=4
3	AFDB:J3KPD6	0.858	0.825	3.302E-74	526	0.640	0.614	J3KPD6.pdb.gz	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
4	AFDB:P08103	0.871	0.840	3.831E-73	524	0.640	0.616	P08103.pdb.gz	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
5	AFDB:Q5ZMB9	0.870	0.893	8.213E-73	492	0.632	0.648	Q5ZMB9.pdb.gz	Q5ZMB9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=LYN PE=1 SV=1
6	AFDB:P07948	0.866	0.854	1.341E-72	512	0.616	0.607	P07948.pdb.gz	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
7	AFDB:P06239	0.871	0.864	4.209E-72	509	0.610	0.605	P06239.pdb.gz	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
8	AFDB:Q66I04	0.877	0.870	3.521E-71	510	0.596	0.590	Q66I04.pdb.gz	Q66I04_DANRE Tyrosine-protein kinase OS=Danio rerio OX=7955 GN=zgc:92124 PE=2 SV=1
9	AFDB:W5U6C9	0.843	0.851	5.580E-69	500	0.592	0.598	W5U6C9.pdb.gz	W5U6C9_ICTPU Tyrosine-protein kinase OS=Ictalurus punctatus OX=7998 GN=LCK PE=2 SV=1
10	AFDB:Q1JPZ3	0.848	0.803	3.590E-65	534	0.556	0.526	Q1JPZ3.pdb.gz	SRC_DANRE Proto-oncogene tyrosine-protein kinase Src OS=Danio rerio OX=7955 GN=src PE=1 SV=2
11	PDB:2h8hA	0.823	0.929	2.900E-59	445	0.550	0.625	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:1k9aB	0.502	0.571	4.074E-38	441	0.341	0.390	1k9aB.pdb.gz
13	PDB:4fl2A	0.484	0.443	4.819E-31	555	0.277	0.252	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:4k2rA	0.489	0.450	3.913E-28	551	0.250	0.229	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
15	PDB:8dksA	0.408	0.698	1.797E-16	283	0.160	0.286	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
16	PDB:6s73A	0.449	0.812	7.404E-16	269	0.127	0.238	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
17	PDB:7mfdA	0.456	0.553	8.256E-16	410	0.178	0.220	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
18	PDB:4btfA	0.442	0.533	1.503E-15	413	0.133	0.162	4btfA.pdb.gz
19	PDB:4krcA	0.420	0.687	1.503E-15	297	0.133	0.226	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
20	PDB:7lhwA	0.411	0.123	6.908E-15	1813	0.206	0.057	7lhwA.pdb.gz	Structural analysis of the full-length human LRRK2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1A5H8	572	546	0.556	0.515	YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio OX=7955 GN=yes1 PE=1 SV=1
2	E1BIM8	565	688	0.550	0.404	E1BIM8_BOVIN Tyrosine-protein kinase OS=Bos taurus OX=9913 GN=SRC PE=3 SV=2
3	F1LM93	568	541	0.550	0.514	YES_RAT Tyrosine-protein kinase Yes OS=Rattus norvegicus OX=10116 GN=Yes1 PE=1 SV=1
4	F1NQU9	570	534	0.554	0.524	F1NQU9_CHICK Tyrosine-protein kinase OS=Gallus gallus OX=9031 GN=FYN PE=3 SV=3
5	F1RDG9	580	544	0.554	0.515	FYNB_DANRE Tyrosine-protein kinase fynb OS=Danio rerio OX=7955 GN=fynb PE=2 SV=1
6	H0Y3C5	665	525	0.614	0.590	H0Y3C5_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
7	J3KPD6	665	526	0.614	0.589	J3KPD6_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=1
8	J3QRU1	566	548	0.550	0.507	J3QRU1_HUMAN Tyrosine-protein kinase OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=1
9	P00523	568	533	0.552	0.523	SRC_CHICK Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4
10	P05480	566	535	0.552	0.521	SRC_MOUSE Proto-oncogene tyrosine-protein kinase Src OS=Mus musculus OX=10090 GN=Src PE=1 SV=5
11	P06239	643	509	0.604	0.599	LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens OX=9606 GN=LCK PE=1 SV=6
12	P06240	640	509	0.620	0.615	LCK_MOUSE Proto-oncogene tyrosine-protein kinase LCK OS=Mus musculus OX=10090 GN=Lck PE=1 SV=4
13	P06241	582	537	0.560	0.527	FYN_HUMAN Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3
14	P07947	566	543	0.550	0.512	YES_HUMAN Tyrosine-protein kinase Yes OS=Homo sapiens OX=9606 GN=YES1 PE=1 SV=3
15	P07948	645	512	0.618	0.609	LYN_HUMAN Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN PE=1 SV=3
16	P08103	659	524	0.614	0.592	HCK_MOUSE Tyrosine-protein kinase HCK OS=Mus musculus OX=10090 GN=Hck PE=1 SV=4
17	P08631	665	526	0.614	0.589	HCK_HUMAN Tyrosine-protein kinase HCK OS=Homo sapiens OX=9606 GN=HCK PE=1 SV=5
18	P09324	569	541	0.560	0.523	YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus OX=9031 GN=YES1 PE=1 SV=3
19	P09769	553	529	0.537	0.512	FGR_HUMAN Tyrosine-protein kinase Fgr OS=Homo sapiens OX=9606 GN=FGR PE=1 SV=2
20	P12931	566	536	0.550	0.519	SRC_HUMAN Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	52	14.4	ABC1 atypical kinase-like domain
2	PF12330 Haspin_kinase	52	14.2	Haspin like kinase domain
3	PF00069 Pkinase	4.8e-41	152.5	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	9.8e-88	305.4	Protein tyrosine and serine/threonine kinase
5	PF00017 SH2	3.4e-19	80.0	SH2 domain
6	PF00018 SH3_1	1.6e-11	55.0	SH3 domain
7	PF18348 SH3_16	1.9e+02	13.2	Bacterial dipeptidyl-peptidase Sh3 domain
8	PF07653 SH3_2	0.00017	32.7	Variant SH3 domain
9	PF08239 SH3_3	14	17.5	Bacterial SH3 domain
10	PF14604 SH3_9	0.00015	32.9	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000259089

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221972	0.982	B-cell antigen receptor complex-associated protein alpha chain
2	9606.ENSP00000275493	0.977	Epidermal growth factor receptor
3	9606.ENSP00000376544	0.977	B-cell antigen receptor complex-associated protein beta chain
4	9606.ENSP00000264657	0.975	Signal transducer and activator of transcription 3
5	9606.ENSP00000264033	0.971	E3 ubiquitin-protein ligase CBL
6	9606.ENSP00000224337	0.950	B-cell linker protein
7	9606.ENSP00000267257	0.949	Paxillin
8	9606.ENSP00000377782	0.948	ETS-related transcription factor Elf-2
9	9606.ENSP00000482457	0.947	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
10	9606.ENSP00000350844	0.938	Paired box protein Pax-5
11	9606.ENSP00000244007	0.933	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
12	9606.ENSP00000264972	0.925	Tyrosine-protein kinase ZAP-70
13	9606.ENSP00000220003	0.923	Tyrosine-protein kinase CSK
14	9606.ENSP00000239882	0.923	ETS-related transcription factor Elf-1
15	9606.ENSP00000265171	0.922	Pro-epidermal growth factor
16	9606.ENSP00000364907	0.921	Tyrosine-protein kinase SYK
17	9606.ENSP00000431254	0.921	Immunoglobulin lambda like polypeptide 5
18	9606.ENSP00000229795	0.920	Mitogen-activated protein kinase 14
19	9606.ENSP00000333685	0.920	Mitogen-activated protein kinase 11
20	9606.ENSP00000483570	0.920	Tyrosine-protein kinase BTK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004715	0.971	non-membrane spanning protein tyrosine kinase activity
GO:0005102	0.760	signaling receptor binding
GO:0019899	0.715	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050896	0.993	response to stimulus
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0051716	0.984	cellular response to stimulus
GO:0023052	0.983	signaling
GO:0007154	0.982	cell communication
GO:0048522	0.979	positive regulation of cellular process
GO:0007165	0.971	signal transduction
GO:0071704	0.964	organic substance metabolic process
GO:0016310	0.964	phosphorylation
GO:0048583	0.958	regulation of response to stimulus
GO:0044238	0.957	primary metabolic process
GO:1901564	0.948	organonitrogen compound metabolic process
GO:0006468	0.943	protein phosphorylation
GO:0002682	0.941	regulation of immune system process
GO:0002684	0.928	positive regulation of immune system process
GO:0050776	0.927	regulation of immune response
GO:0050778	0.914	positive regulation of immune response
GO:0007166	0.910	cell surface receptor signaling pathway
GO:0002768	0.900	immune response-regulating cell surface receptor signaling pathway
GO:0002253	0.872	activation of immune response
GO:0018212	0.866	peptidyl-tyrosine modification
GO:0018108	0.864	peptidyl-tyrosine phosphorylation
GO:0002429	0.850	immune response-activating cell surface receptor signaling pathway
GO:0010646	0.817	regulation of cell communication
GO:0023051	0.800	regulation of signaling
GO:0019222	0.710	regulation of metabolic process
GO:0032879	0.675	regulation of localization
GO:0050851	0.662	antigen receptor-mediated signaling pathway
GO:0065009	0.642	regulation of molecular function
GO:0032501	0.512	multicellular organismal process
GO:0060255	0.501	regulation of macromolecule metabolic process
GO:0080090	0.466	regulation of primary metabolic process
GO:0042221	0.464	response to chemical
GO:0031323	0.457	regulation of cellular metabolic process
GO:0010647	0.450	positive regulation of cell communication
GO:0048519	0.445	negative regulation of biological process
GO:0051171	0.445	regulation of nitrogen compound metabolic process
GO:0009966	0.445	regulation of signal transduction
GO:0048523	0.436	negative regulation of cellular process
GO:0009893	0.426	positive regulation of metabolic process
GO:0051239	0.415	regulation of multicellular organismal process
GO:0010604	0.408	positive regulation of macromolecule metabolic process
GO:0032502	0.386	developmental process
GO:0048856	0.351	anatomical structure development
GO:0044093	0.333	positive regulation of molecular function
GO:0042325	0.329	regulation of phosphorylation
GO:0023056	0.326	positive regulation of signaling
GO:0050790	0.309	regulation of catalytic activity
GO:0031325	0.306	positive regulation of cellular metabolic process
GO:0070887	0.300	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.966	plasma membrane
GO:0043227	0.824	membrane-bounded organelle
GO:0043231	0.783	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.2	0.971	non-specific protein-tyrosine kinase.

[back to server]