StarFunc result for job id P51452

User Input

>input (185 residues)
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K3I9	0.991	0.870	2.990E-33	211	0.914	0.801	A0A0G2K3I9.pdb.gz	A0A0G2K3I9_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=1 SV=2
2	AFDB:G3V9L3	0.991	0.955	3.344E-33	192	0.919	0.885	G3V9L3.pdb.gz	G3V9L3_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=3 SV=3
3	PDB:3f81A	0.954	0.986	3.331E-31	179	0.968	1.000	3f81A.pdb.gz	Multidentate small-molecule inhibitors of vaccinia H1-related (VHR) phosphatase decrease proliferation of cervix cancer cells.
4	AFDB:Q68J44	0.868	0.734	1.263E-17	220	0.416	0.350	Q68J44.pdb.gz	DUS29_HUMAN Dual specificity phosphatase 29 OS=Homo sapiens OX=9606 GN=DUSP29 PE=1 SV=1
5	AFDB:Q8BK84	0.882	0.761	1.672E-17	215	0.411	0.353	Q8BK84.pdb.gz	DUS29_MOUSE Dual specificity phosphatase 29 OS=Mus musculus OX=10090 GN=Dusp29 PE=1 SV=1
6	AFDB:Q6B8I1	0.868	0.854	2.092E-17	188	0.411	0.404	Q6B8I1.pdb.gz	DS13A_HUMAN Dual specificity protein phosphatase 13A OS=Homo sapiens OX=9606 GN=DUSP13A PE=1 SV=1
7	AFDB:Q6B8I0	0.884	0.870	3.464E-17	188	0.422	0.415	Q6B8I0.pdb.gz	DS13A_MOUSE Dual specificity protein phosphatase 13A OS=Mus musculus OX=10090 GN=Dusp13a PE=2 SV=1
8	AFDB:Q9BV47	0.871	0.766	8.492E-17	211	0.384	0.336	Q9BV47.pdb.gz	DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens OX=9606 GN=DUSP26 PE=1 SV=1
9	AFDB:Q9UII6	0.887	0.830	1.487E-16	198	0.416	0.389	Q9UII6.pdb.gz	DS13B_HUMAN Dual specificity protein phosphatase 13B OS=Homo sapiens OX=9606 GN=DUSP13B PE=1 SV=3
10	PDB:2gwoC	0.875	0.929	5.428E-16	174	0.405	0.431	2gwoC.pdb.gz
11	AFDB:F1QWM2	0.888	0.154	7.144E-16	1100	0.395	0.066	F1QWM2.pdb.gz	STYL2_DANRE Serine/threonine/tyrosine-interacting-like protein 2 OS=Danio rerio OX=7955 GN=styxl2 PE=1 SV=1
12	PDB:2y96A	0.803	0.848	1.258E-15	175	0.422	0.446	2y96A.pdb.gz
13	AFDB:Q9QYJ7	0.899	0.841	1.852E-15	198	0.400	0.374	Q9QYJ7.pdb.gz	DS13B_MOUSE Dual specificity protein phosphatase 13B OS=Mus musculus OX=10090 GN=Dusp13b PE=1 SV=1
14	PDB:5xjvB	0.793	0.856	2.607E-15	171	0.378	0.409	5xjvB.pdb.gz
15	PDB:5y15A	0.713	0.880	9.282E-11	148	0.211	0.264	5y15A.pdb.gz
16	PDB:2wgpA	0.712	0.780	1.299E-10	168	0.265	0.292	2wgpA.pdb.gz
17	PDB:6d66A	0.688	0.256	2.407E-10	517	0.286	0.103	6d66A.pdb.gz
18	PDB:2esbA	0.680	0.771	1.446E-9	162	0.276	0.315	2esbA.pdb.gz
19	PDB:2q05A	0.622	0.634	1.205E-6	181	0.238	0.243	2q05A.pdb.gz
20	PDB:4rkkA	0.620	0.384	1.508E-6	317	0.195	0.114	4rkkA.pdb.gz	Structural mechanism of laforin function in glycogen dephosphorylation and lafora disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51452	1.82e-138	385	185	1.000	1.000	DUS3_HUMAN Dual specificity protein phosphatase 3 OS=Homo sapiens OX=9606 GN=DUSP3 PE=1 SV=1
2	Q9D7X3	1.57e-129	362	185	0.930	0.930	DUS3_MOUSE Dual specificity protein phosphatase 3 OS=Mus musculus OX=10090 GN=Dusp3 PE=1 SV=1
3	B5DFF7	3.54e-129	362	185	0.919	0.919	B5DFF7_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=2 SV=1
4	G3V9L3	2.52e-128	360	211	0.919	0.806	G3V9L3_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=3 SV=3
5	A0A8I6AF61	4.37e-127	357	212	0.914	0.797	A0A8I6AF61_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=1 SV=1
6	A0A0G2K3I9	5.88e-79	233	145	0.595	0.759	A0A0G2K3I9_RAT Dual specificity protein phosphatase OS=Rattus norvegicus OX=10116 GN=Dusp3 PE=1 SV=2
7	K7ELG5	7.13e-53	166	112	0.465	0.768	K7ELG5_HUMAN protein-serine/threonine phosphatase (Fragment) OS=Homo sapiens OX=9606 GN=DUSP3 PE=1 SV=1
8	Q6B8I0	3.64e-44	146	188	0.432	0.426	DS13A_MOUSE Dual specificity protein phosphatase 13A OS=Mus musculus OX=10090 GN=Dusp13a PE=2 SV=1
9	Q6B8I1	9.88e-44	145	188	0.422	0.415	DS13A_HUMAN Dual specificity protein phosphatase 13A OS=Homo sapiens OX=9606 GN=DUSP13A PE=1 SV=1
10	Q68J44	3.34e-42	142	220	0.422	0.355	DUS29_HUMAN Dual specificity phosphatase 29 OS=Homo sapiens OX=9606 GN=DUSP29 PE=1 SV=1
11	Q8BK84	3.45e-42	142	215	0.427	0.367	DUS29_MOUSE Dual specificity phosphatase 29 OS=Mus musculus OX=10090 GN=Dusp29 PE=1 SV=1
12	Q9UII6	3.51e-40	137	198	0.384	0.359	DS13B_HUMAN Dual specificity protein phosphatase 13B OS=Homo sapiens OX=9606 GN=DUSP13B PE=1 SV=3
13	Q9D700	2.38e-38	132	211	0.395	0.346	DUS26_MOUSE Dual specificity protein phosphatase 26 OS=Mus musculus OX=10090 GN=Dusp26 PE=2 SV=2
14	Q9BV47	2.68e-38	132	211	0.395	0.346	DUS26_HUMAN Dual specificity protein phosphatase 26 OS=Homo sapiens OX=9606 GN=DUSP26 PE=1 SV=1
15	Q9QYJ7	2.38e-37	129	198	0.373	0.348	DS13B_MOUSE Dual specificity protein phosphatase 13B OS=Mus musculus OX=10090 GN=Dusp13b PE=1 SV=1
16	F1QWM2	4.45e-33	126	1100	0.362	0.061	STYL2_DANRE Serine/threonine/tyrosine-interacting-like protein 2 OS=Danio rerio OX=7955 GN=styxl2 PE=1 SV=1
17	Q05923	5.47e-21	89.7	314	0.281	0.166	DUS2_HUMAN Dual specificity protein phosphatase 2 OS=Homo sapiens OX=9606 GN=DUSP2 PE=1 SV=1
18	Q05922	5.93e-21	89.7	318	0.281	0.164	DUS2_MOUSE Dual specificity protein phosphatase 2 OS=Mus musculus OX=10090 GN=Dusp2 PE=1 SV=2
19	Q8WTR2	8.37e-21	87.4	217	0.297	0.253	DUS19_HUMAN Dual specificity protein phosphatase 19 OS=Homo sapiens OX=9606 GN=DUSP19 PE=1 SV=1
20	Q16690	1.71e-20	89.4	384	0.276	0.133	DUS5_HUMAN Dual specificity protein phosphatase 5 OS=Homo sapiens OX=9606 GN=DUSP5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04273 BLH_phosphatase	5e+02	12.3	Beta-lactamase hydrolase-like protein, phosphatase-like domain
2	PF00782 DSPc	2.3e-36	136.0	Dual specificity phosphatase, catalytic domain
3	PF04179 Init_tRNA_PT	2.6	19.8	Rit1 DUSP-like domain
4	PF00102 Y_phosphatase	0.64	21.1	Protein-tyrosine phosphatase
5	PF03162 Y_phosphatase2	5	18.2	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010374534.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010380076.1	0.972	Mitogen-activated protein kinase 1
2	61622.XP_010385672.1	0.959	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
3	61622.XP_010377150.1	0.911	Tyrosine-protein phosphatase non-receptor type 7 isoform X1
4	61622.XP_010367830.1	0.907	Inactive serine/threonine-protein kinase VRK3 isoform X1
5	61622.XP_010379260.1	0.884	Mitogen-activated protein kinase 9
6	61622.XP_010359544.1	0.846	Mitogen-activated protein kinase 12
7	61622.XP_010387975.1	0.844	Mitogen-activated protein kinase 14
8	61622.XP_010387980.1	0.844	Mitogen-activated protein kinase 13
9	61622.XP_010357065.1	0.838	Receptor-type tyrosine-protein phosphatase R
10	61622.XP_010368486.1	0.832	Tyrosine-protein phosphatase non-receptor type 5 isoform X1
11	61622.XP_010368913.1	0.822	Mitogen-activated protein kinase 10
12	61622.XP_010382026.1	0.820	Mitogen-activated protein kinase 8
13	61622.XP_010359458.1	0.753	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
14	61622.XP_010378925.1	0.716	Ataxin-7-like protein 1 isoform X1
15	61622.XP_010365027.1	0.690	Acts as an adapter for the XPO1/CRM1-mediated export of the 60S ribosomal subunit
16	61622.XP_010356063.1	0.684	Midasin AAA ATPase 1
17	61622.XP_010376117.1	0.665	Proliferation-associated protein 2G4
18	61622.XP_010375950.1	0.660	Serine/threonine-protein kinase VRK2 isoform X1
19	61622.XP_010372231.1	0.653	Zinc finger protein 639
20	61622.XP_010351979.1	0.640	Belongs to the protein kinase superfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008138	1.000	protein tyrosine/serine/threonine phosphatase activity
GO:0019899	0.694	enzyme binding
GO:0004725	0.618	protein tyrosine phosphatase activity
GO:0033549	0.548	MAP kinase phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.984	regulation of cellular process
GO:0044237	0.976	cellular metabolic process
GO:0001952	0.971	regulation of cell-matrix adhesion
GO:0150116	0.970	regulation of cell-substrate junction organization
GO:0071704	0.968	organic substance metabolic process
GO:0051893	0.955	regulation of focal adhesion assembly
GO:0016311	0.954	dephosphorylation
GO:0050896	0.951	response to stimulus
GO:0044238	0.951	primary metabolic process
GO:0048519	0.937	negative regulation of biological process
GO:0043170	0.932	macromolecule metabolic process
GO:0006807	0.928	nitrogen compound metabolic process
GO:0009968	0.927	negative regulation of signal transduction
GO:0070849	0.879	response to epidermal growth factor
GO:0035335	0.878	peptidyl-tyrosine dephosphorylation
GO:0019222	0.874	regulation of metabolic process
GO:0031400	0.858	negative regulation of protein modification process
GO:0045936	0.850	negative regulation of phosphate metabolic process
GO:0051338	0.825	regulation of transferase activity
GO:0001933	0.825	negative regulation of protein phosphorylation
GO:0006469	0.823	negative regulation of protein kinase activity
GO:0048518	0.822	positive regulation of biological process
GO:0071364	0.818	cellular response to epidermal growth factor stimulus
GO:0048522	0.796	positive regulation of cellular process
GO:0043408	0.795	regulation of MAPK cascade
GO:0022407	0.767	regulation of cell-cell adhesion
GO:0080134	0.760	regulation of response to stress
GO:0002683	0.758	negative regulation of immune system process
GO:1903037	0.754	regulation of leukocyte cell-cell adhesion
GO:0050776	0.725	regulation of immune response
GO:0050865	0.710	regulation of cell activation
GO:0040012	0.670	regulation of locomotion
GO:0022408	0.668	negative regulation of cell-cell adhesion
GO:0002694	0.636	regulation of leukocyte activation
GO:0002695	0.578	negative regulation of leukocyte activation
GO:1903038	0.565	negative regulation of leukocyte cell-cell adhesion
GO:0070302	0.553	regulation of stress-activated protein kinase signaling cascade
GO:0051716	0.519	cellular response to stimulus
GO:0051249	0.502	regulation of lymphocyte activation
GO:0043409	0.502	negative regulation of MAPK cascade
GO:0070303	0.444	negative regulation of stress-activated protein kinase signaling cascade
GO:0051250	0.410	negative regulation of lymphocyte activation
GO:0032502	0.355	developmental process
GO:0007165	0.340	signal transduction
GO:0010468	0.308	regulation of gene expression
GO:0032501	0.300	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0016020	0.993	membrane
GO:0005829	0.990	cytosol
GO:0071944	0.946	cell periphery
GO:0005886	0.943	plasma membrane
GO:0001772	0.632	immunological synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:10684	0.618	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.618	protein-tyrosine-phosphatase.

[back to server]