StarFunc result for job id P51523

User Input

>input (738 residues)
MTMLQESFSFDDLSVDFTQKEWQLLDPSQKNLYKDVMLENYSSLVSLGYEVMKPDVIFKL
EQGEEPWVGDGEIPSSDSPEVWKVDGNMMWHQDNQDKLKIIKRGHECDAFGKNFNLNMNF
VPLRKSNSEGDLDGLILKHHLDLLIPKGDYGKAESDDFNVFDNFFLHSKPEDTDTWLKYY
DCDKYKESYKKSQIIIYHRNRLGEKLYECSECRKRFSKKPSLIKHQSRHIRDIAFGCGNC
GKTFPQKSQFITHHRTHTGEKPYNCSQCGKAFSQKSQLTSHQRTHTGEKPYECGECGKAF
SRKSHLISHWRTHTGEKPYGCNECGRAFSEKSNLINHQRIHTGEKPFECRECGKAFSRKS
QLVTHHRTHTGTKPFGCSDCRKAFFEKSELIRHQTIHTGEKPYECSECRKAFRERSSLIN
HQRTHTGEKPHGCIQCGKAFSQKSHLISHQMTHTGEKPFICSKCGKAFSRKSQLVRHQRT
HTGEKPYECSECGKAFSEKLSLTNHQRIHTGEKPYVCSECGKAFCQKSHLISHQRTHTGE
KPYECSECGKAFGEKSSLATHQRTHTGEKPYECRDCEKAFSQKSQLNTHQRIHTGEKPYE
CSLCRKAFFEKSELIRHLRTHTGEKPYECNECRKAFREKSSLINHQRIHTGEKPFECSEC
GKAFSRKSHLIPHQRTHTGEKPYGCSECRKAFSQKSQLVNHQRIHTGEKPYRCIECGKAF
SQKSQLINHQRTHTVKKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51523	1.000	1.000	0.000	738	1.000	1.000	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
2	AFDB:Q14587	0.551	0.444	1.914E-82	947	0.584	0.455	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
3	AFDB:Q5TYW1	0.629	0.450	3.113E-71	1059	0.537	0.374	Q5TYW1.pdb.gz	ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens OX=9606 GN=ZNF658 PE=1 SV=2
4	AFDB:Q6ECI4	0.599	0.615	6.079E-71	717	0.488	0.502	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
5	AFDB:Q06732	0.559	0.532	7.901E-70	778	0.537	0.509	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
6	AFDB:A0A1B0GR71	0.241	0.195	6.218E-69	966	0.501	0.383	A0A1B0GR71.pdb.gz	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
7	AFDB:Q9Y3M9	0.448	0.442	1.435E-68	751	0.431	0.423	Q9Y3M9.pdb.gz	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
8	AFDB:Q62788	0.377	0.374	4.139E-68	744	0.447	0.444	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
9	AFDB:P17038	0.375	0.349	7.229E-68	809	0.472	0.430	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
10	AFDB:A6NNF4	0.544	0.544	1.010E-67	738	0.455	0.455	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
11	PDB:3w5kB	0.071	0.266	1.794E-4	110	0.068	0.455	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7ena4	0.063	0.086	1.804E-1	457	0.072	0.116	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:4fjcE	0.038	0.055	4.922E-1	434	0.039	0.067	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:7o4iW	0.045	0.080	6.878E-1	312	0.047	0.112	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
15	PDB:4yrvA	0.048	0.090	9.090E-1	288	0.042	0.108	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation
16	PDB:7ad8D	0.041	0.077	9.090E-1	280	0.033	0.086	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
17	PDB:8ap8d	0.057	0.098	1.201	270	0.042	0.115	8ap8d.pdb.gz
18	PDB:6w6jD	0.067	0.069	1.501	707	0.065	0.068	6w6jD.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
19	PDB:5a31B	0.031	0.156	1.678	84	0.020	0.179	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
20	PDB:2kr0A	0.050	0.071	2.098	407	0.054	0.098	2kr0A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WSF4	538	635	0.369	0.428	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
2	A0A0A0MS50	590	604	0.434	0.530	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
3	A0A0U1RQ46	547	609	0.389	0.471	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
4	A0A1B0GR71	564	966	0.420	0.321	A0A1B0GR71_MOUSE Predicted gene 4924 OS=Mus musculus OX=10090 GN=Gm4924 PE=1 SV=1
5	A0A8I6G8Y2	550	723	0.439	0.448	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
6	A6NNF4	560	616	0.421	0.505	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
7	A8K8Y5	578	707	0.424	0.443	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
8	E9Q981	538	636	0.369	0.428	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
9	G3V9G6	565	740	0.447	0.446	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
10	O75290	537	641	0.360	0.415	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
11	O75437	542	659	0.416	0.466	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
12	O94892	568	652	0.392	0.443	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
13	P15620	543	580	0.364	0.464	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
14	P17014	649	697	0.484	0.512	ZNF12_HUMAN Zinc finger protein 12 OS=Homo sapiens OX=9606 GN=ZNF12 PE=1 SV=3
15	P17020	538	682	0.379	0.411	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
16	P17021	571	662	0.396	0.441	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
17	P17027	551	643	0.378	0.434	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
18	P17038	564	809	0.408	0.372	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
19	P17097	571	686	0.450	0.484	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
20	P35789	566	620	0.420	0.500	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	1.4e-19	80.7	KRAB box
2	PF01429 MBD	7e+02	11.3	Methyl-CpG binding domain
3	PF01286 XPA_N	2e+02	13.4	XPA protein N-terminal
4	PF00096 zf-C2H2	3.5e-104	346.9	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	7.3e+02	11.4	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	7.6e-63	214.7	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	5.7e-11	53.4	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	6.7e-17	72.5	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	5.3e-148	486.9	Zinc-finger double domain
10	PF13909 zf-H2C2_5	2.7e+02	12.7	C2H2-type zinc-finger domain
11	PF18439 zf_UBZ	0.094	23.7	Ubiquitin-Binding Zinc Finger
12	PF17032 zinc_ribbon_15	2e-07	43.0	zinc-ribbon family
13	PF09723 Zn-ribbon_8	0.03	25.8	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331465

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387617	0.541	Single-pass membrane protein with coiled-coil domains 2
2	9606.ENSP00000355251	0.511	Zinc finger protein 511

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.582	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.970	regulation of biological process
GO:0050794	0.964	regulation of cellular process
GO:0009889	0.935	regulation of biosynthetic process
GO:0010556	0.930	regulation of macromolecule biosynthetic process
GO:0031326	0.928	regulation of cellular biosynthetic process
GO:0051171	0.921	regulation of nitrogen compound metabolic process
GO:0080090	0.915	regulation of primary metabolic process
GO:0010468	0.915	regulation of gene expression
GO:0051252	0.889	regulation of RNA metabolic process
GO:0006355	0.881	regulation of DNA-templated transcription
GO:0048519	0.797	negative regulation of biological process
GO:0048523	0.634	negative regulation of cellular process
GO:0009987	0.371	cellular process
GO:0010558	0.308	negative regulation of macromolecule biosynthetic process
GO:0031327	0.307	negative regulation of cellular biosynthetic process
GO:0045934	0.307	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.302	negative regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.999	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0043228	0.476	non-membrane-bounded organelle
GO:0043232	0.466	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]