StarFunc result for job id P51530

User Input

>input (1060 residues)
MEQLNELELLMEKSFWEEAELPAELFQKKVVASFPRTVLSTGMDNRYLVLAVNTVQNKEG
NCEKRLVITASQSLENKELCILRNDWCSVPVEPGDIIHLEGDCTSDTWIIDKDFGYLILY
PDMLISGTSIASSIRCMRRAVLSETFRSSDPATRQMLIGTVLHEVFQKAINNSFAPEKLQ
ELAFQTIQEIRHLKEMYRLNLSQDEIKQEVEDYLPSFCKWAGDFMHKNTSTDFPQMQLSL
PSDNSKDNSTCNIEVVKPMDIEESIWSPRFGLKGKIDVTVGVKIHRGYKTKYKIMPLELK
TGKESNSIEHRSQVVLYTLLSQERRADPEAGLLLYLKTGQMYPVPANHLDKRELLKLRNQ
MAFSLFHRISKSATRQKTQLASLPQIIEEEKTCKYCSQIGNCALYSRAVEQQMDCSSVPI
VMLPKIEEETQHLKQTHLEYFSLWCLMLTLESQSKDNKKNHQNIWLMPASEMEKSGSCIG
NLIRMEHVKIVCDGQYLHNFQCKHGAIPVTNLMAGDRVIVSGEERSLFALSRGYVKEINM
TTVTCLLDRNLSVLPESTLFRLDQEEKNCDIDTPLGNLSKLMENTFVSKKLRDLIIDFRE
PQFISYLSSVLPHDAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTICT
LVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQIQKVHPAIQQFTEQEICRS
KSIKSLALLEELYNSQLIVATTCMGINHPIFSRKIFDFCIVDEASQISQPICLGPLFFSR
RFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQNKSAVVQLTVQYRMNSKIMSLSNKL
TYEGKLECGSDKVANAVINLRHFKDVKLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKV
PAPEQVEKGGVSNVTEAKLIVFLTSIFVKAGCSPSDIGIIAPYRQQLKIINDLLARSIGM
VEVNTVDKYQGRDKSIVLVSFVRSNKDGTVGELLKDWRRLNVAITRAKHKLILLGCVPSL
NCYPPLEKLLNHLNSEKLIIDLPSREHESLCHILGDFQRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5eanA	0.976	0.984	0.000	1051	0.792	0.799	5eanA.pdb.gz	Dna2 nuclease-helicase structure, mechanism and regulation by Rpa.
2	AFDB:F8VR31	0.745	0.910	0.000	867	0.756	0.924	F8VR31.pdb.gz	F8VR31_HUMAN DNA replication ATP-dependent helicase/nuclease OS=Homo sapiens OX=9606 GN=DNA2 PE=1 SV=3
3	AFDB:P51530	1.000	1.000	0.000	1060	1.000	1.000	P51530.pdb.gz	DNA2_HUMAN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens OX=9606 GN=DNA2 PE=1 SV=3
4	AFDB:Q6ZQJ5	0.971	0.969	0.000	1062	0.798	0.797	Q6ZQJ5.pdb.gz	DNA2_MOUSE DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus OX=10090 GN=Dna2 PE=1 SV=2
5	AFDB:Q8QHA5	0.931	0.937	0.000	1053	0.620	0.624	Q8QHA5.pdb.gz	DNA2_XENLA DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis OX=8355 GN=dna2 PE=1 SV=1
6	AFDB:A0A1P8ASY1	0.826	0.665	3.954E-89	1331	0.320	0.255	A0A1P8ASY1.pdb.gz	JHS1_ARATH DNA replication ATP-dependent helicase/nuclease JHS1 OS=Arabidopsis thaliana OX=3702 GN=JHS1 PE=2 SV=1
7	AFDB:Q9URU2	0.830	0.634	8.790E-85	1397	0.324	0.246	Q9URU2.pdb.gz	DNA2_SCHPO DNA replication ATP-dependent helicase/nuclease dna2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dna2 PE=1 SV=2
8	AFDB:P38859	0.809	0.578	5.877E-80	1522	0.315	0.219	P38859.pdb.gz	DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DNA2 PE=1 SV=1
9	AFDB:Q9U3F2	0.818	0.811	4.568E-76	1069	0.287	0.284	Q9U3F2.pdb.gz	Q9U3F2_CAEEL DNA replication ATP-dependent helicase/nuclease OS=Caenorhabditis elegans OX=6239 GN=dna-2 PE=1 SV=1
10	AFDB:O81047	0.481	0.780	4.281E-43	639	0.147	0.244	O81047.pdb.gz	O81047_ARATH DNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=At2g03270 PE=1 SV=2
11	AFDB:P40694	0.485	0.516	1.164E-41	993	0.159	0.170	P40694.pdb.gz	SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus OX=10090 GN=Ighmbp2 PE=1 SV=1
12	PDB:4pj3A	0.356	0.288	9.729E-26	1335	0.144	0.115	4pj3A.pdb.gz	The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.
13	PDB:3jb9X	0.332	0.299	1.597E-14	1195	0.103	0.091	3jb9X.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:5ld2D	0.224	0.369	4.562E-11	605	0.075	0.132	5ld2D.pdb.gz	Mechanism for nuclease regulation in RecBCD.
15	PDB:3k70D	0.206	0.369	2.764E-10	547	0.071	0.137	3k70D.pdb.gz	DNA binding to RecD: role of the 1B domain in SF1B helicase activity.
16	PDB:7zelA	0.198	0.248	2.499E-8	827	0.055	0.070	7zelA.pdb.gz	Mechanistic understanding of human SLFN11.
17	PDB:3jcmN	0.193	0.132	5.565E-8	1686	0.084	0.053	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
18	PDB:3upuA	0.183	0.406	6.799E-8	439	0.060	0.146	3upuA.pdb.gz	The T4 Phage SF1B Helicase Dda Is Structurally Optimized to Perform DNA Strand Separation.
19	PDB:2is6A	0.195	0.300	1.370E-7	654	0.075	0.122	2is6A.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.
20	PDB:2is4B	0.200	0.319	2.626E-7	632	0.071	0.119	2is4B.pdb.gz	UvrD helicase unwinds DNA one base pair at a time by a two-part power stroke.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8VR31	0.0	1377	867	0.625	0.764	F8VR31_HUMAN DNA replication ATP-dependent helicase/nuclease OS=Homo sapiens OX=9606 GN=DNA2 PE=1 SV=3
2	P51530	0.0	2195	1060	1.000	1.000	DNA2_HUMAN DNA replication ATP-dependent helicase/nuclease DNA2 OS=Homo sapiens OX=9606 GN=DNA2 PE=1 SV=3
3	Q6ZQJ5	0.0	1755	1062	0.792	0.791	DNA2_MOUSE DNA replication ATP-dependent helicase/nuclease DNA2 OS=Mus musculus OX=10090 GN=Dna2 PE=1 SV=2
4	Q8QHA5	0.0	1343	1053	0.625	0.629	DNA2_XENLA DNA replication ATP-dependent helicase/nuclease DNA2 OS=Xenopus laevis OX=8355 GN=dna2 PE=1 SV=1
5	A0A1P8ASY1	1.02e-154	496	1331	0.334	0.266	JHS1_ARATH DNA replication ATP-dependent helicase/nuclease JHS1 OS=Arabidopsis thaliana OX=3702 GN=JHS1 PE=2 SV=1
6	Q9URU2	8.24e-148	479	1397	0.324	0.246	DNA2_SCHPO DNA replication ATP-dependent helicase/nuclease dna2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dna2 PE=1 SV=2
7	P38859	5.27e-135	446	1522	0.326	0.227	DNA2_YEAST DNA replication ATP-dependent helicase/nuclease DNA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DNA2 PE=1 SV=1
8	Q9U3F2	9.65e-125	409	1069	0.291	0.288	Q9U3F2_CAEEL DNA replication ATP-dependent helicase/nuclease OS=Caenorhabditis elegans OX=6239 GN=dna-2 PE=1 SV=1
9	A0A024R7L5	1.08e-45	181	1118	0.130	0.123	A0A024R7L5_HUMAN UPF1 OS=Homo sapiens OX=9606 GN=UPF1 PE=2 SV=1
10	F1RCY6	1.29e-45	181	1100	0.130	0.125	RENT1_DANRE Regulator of nonsense transcripts 1 OS=Danio rerio OX=7955 GN=upf1 PE=2 SV=1
11	Q92900	1.47e-45	181	1129	0.130	0.122	RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens OX=9606 GN=UPF1 PE=1 SV=2
12	Q9EPU0	6.51e-45	179	1124	0.134	0.126	RENT1_MOUSE Regulator of nonsense transcripts 1 OS=Mus musculus OX=10090 GN=Upf1 PE=1 SV=2
13	Q9VYS3	9.03e-45	179	1180	0.132	0.119	RENT1_DROME Regulator of nonsense transcripts 1 homolog OS=Drosophila melanogaster OX=7227 GN=Upf1 PE=1 SV=2
14	P38935	7.56e-44	175	993	0.163	0.174	SMBP2_HUMAN DNA-binding protein SMUBP-2 OS=Homo sapiens OX=9606 GN=IGHMBP2 PE=1 SV=3
15	Q9EQN5	1.44e-43	174	988	0.125	0.134	SMBP2_RAT DNA-binding protein SMUBP-2 OS=Rattus norvegicus OX=10116 GN=Ighmbp2 PE=1 SV=1
16	Q582F1	3.39e-43	172	842	0.136	0.171	Q582F1_TRYB2 Regulator of nonsense transcripts 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.50 PE=3 SV=1
17	P40694	7.33e-43	172	993	0.125	0.133	SMBP2_MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus OX=10090 GN=Ighmbp2 PE=1 SV=1
18	Q9FJR0	1.12e-42	172	1254	0.135	0.114	RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana OX=3702 GN=UPF1 PE=1 SV=2
19	Q09820	1.51e-42	171	925	0.134	0.154	RENT1_SCHPO ATP-dependent helicase upf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf1 PE=3 SV=2
20	O81047	2.23e-41	164	639	0.152	0.252	O81047_ARATH DNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=At2g03270 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13086 AAA_11	5.8e-29	113.2	AAA domain
2	PF13087 AAA_12	1e-51	187.0	AAA domain
3	PF13191 AAA_16	4.4e+02	12.6	AAA ATPase domain
4	PF13245 AAA_19	4.9e-06	38.3	AAA domain
5	PF13481 AAA_25	95	14.0	AAA domain
6	PF13604 AAA_30	7.9e-09	47.0	AAA domain
7	PF12775 AAA_7	3.7e+02	12.0	P-loop containing dynein motor region
8	PF20030 bpMoxR	24	15.4	MoxR domain in the MoxR-vWA-beta-propeller ternary systems
9	PF01930 Cas_Cas4	1.4	20.5	Domain of unknown function DUF83
10	PF01656 CbiA	1.9e+02	13.5	CobQ/CobB/MinD/ParA nucleotide binding domain
11	PF02492 cobW	2.1e+02	12.9	CobW/HypB/UreG, nucleotide-binding domain
12	PF08696 Dna2	1e-58	210.0	DNA replication factor Dna2
13	PF01935 DUF87	3.6e+02	12.6	Helicase HerA, central domain
14	PF05127 Helicase_RecD	45	15.3	Helicase
15	PF03205 MobB	5.4e+02	11.9	Molybdopterin guanine dinucleotide synthesis protein B
16	PF12705 PDDEXK_1	0.00045	31.8	PD-(D/E)XK nuclease superfamily
17	PF02562 PhoH	2.2e+02	12.7	PhoH-like protein
18	PF00448 SRP54	16	16.6	SRP54-type protein, GTPase domain
19	PF00580 UvrD-helicase	3.6e+02	12.1	UvrD/REP helicase N-terminal domain
20	PF13538 UvrD_C_2	1.2e+02	14.0	UvrD-like helicase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353793	0.999	WD repeat and HMG-box DNA-binding protein 1
2	9606.ENSP00000355506	0.999	Exonuclease 1
3	9606.ENSP00000298139	0.997	Werner syndrome ATP-dependent helicase
4	9606.ENSP00000305480	0.997	Flap endonuclease 1
5	9606.ENSP00000254719	0.996	Replication protein A 70 kDa DNA-binding subunit
6	9606.ENSP00000318977	0.994	Flap endonuclease GEN homolog 1
7	9606.ENSP00000442336	0.992	DNA topoisomerase 3-alpha
8	9606.ENSP00000328174	0.990	ATP-dependent DNA helicase PIF1
9	9606.ENSP00000317039	0.989	RecQ-mediated genome instability protein 1
10	9606.ENSP00000347232	0.989	Bloom syndrome protein
11	9606.ENSP00000307853	0.988	Crossover junction endonuclease MUS81
12	9606.ENSP00000351284	0.988	DNA repair protein RAD52 homolog
13	9606.ENSP00000322570	0.980	DNA polymerase epsilon catalytic subunit A
14	9606.ENSP00000372088	0.980	DNA repair protein RAD51 homolog 1
15	9606.ENSP00000278616	0.975	Serine-protein kinase ATM
16	9606.ENSP00000353332	0.970	Regulator of telomere elongation helicase 1
17	9606.ENSP00000343741	0.969	Serine/threonine-protein kinase ATR
18	9606.ENSP00000382628	0.969	DNA endonuclease RBBP8
19	9606.ENSP00000216367	0.965	DNA polymerase epsilon subunit 2
20	9606.ENSP00000376952	0.961	Crossover junction endonuclease EME1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003678	0.999	DNA helicase activity
GO:0017108	0.999	5'-flap endonuclease activity
GO:0003676	0.996	nucleic acid binding
GO:0016887	0.992	ATP hydrolysis activity
GO:0043139	0.987	5'-3' DNA helicase activity
GO:0003677	0.986	DNA binding
GO:0017116	0.986	single-stranded DNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0051716	0.995	cellular response to stimulus
GO:0006259	0.992	DNA metabolic process
GO:0033554	0.991	cellular response to stress
GO:0006974	0.983	cellular response to DNA damage stimulus
GO:0006281	0.966	DNA repair
GO:0016043	0.957	cellular component organization
GO:0006260	0.956	DNA replication
GO:0006302	0.953	double-strand break repair
GO:0051276	0.937	chromosome organization
GO:0006261	0.923	DNA-templated DNA replication
GO:0050789	0.916	regulation of biological process
GO:0007049	0.897	cell cycle
GO:0022402	0.894	cell cycle process
GO:0050794	0.893	regulation of cellular process
GO:0019222	0.803	regulation of metabolic process
GO:0060255	0.714	regulation of macromolecule metabolic process
GO:0051052	0.536	regulation of DNA metabolic process
GO:0048519	0.534	negative regulation of biological process
GO:0032200	0.477	telomere organization
GO:0048518	0.462	positive regulation of biological process
GO:0048523	0.461	negative regulation of cellular process
GO:0048522	0.441	positive regulation of cellular process
GO:0000723	0.436	telomere maintenance
GO:0010564	0.348	regulation of cell cycle process
GO:0010604	0.312	positive regulation of macromolecule metabolic process
GO:0051173	0.309	positive regulation of nitrogen compound metabolic process
GO:0031325	0.306	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0032991	0.997	protein-containing complex
GO:0005654	0.997	nucleoplasm
GO:0005739	0.897	mitochondrion
GO:1902494	0.867	catalytic complex
GO:0005694	0.691	chromosome
GO:1990234	0.533	transferase complex
GO:0042575	0.519	DNA polymerase complex
GO:0005759	0.387	mitochondrial matrix
GO:0000781	0.353	chromosome, telomeric region
GO:0009295	0.342	nucleoid
GO:0042645	0.329	mitochondrial nucleoid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.21.-	1.000	Endodeoxyribonucleases producing 5'-phosphomonoesters.
RHEA:13065	0.992	ATP + H2O = ADP + H(+) + phosphate
EC:5.6.2.3	0.987	DNA 5'-3' helicase.

[back to server]