StarFunc result for job id P51531

User Input

>input (1590 residues)
MSTPTDPGAMPHPGPSPGPGPSPGPILGPSPGPGPSPGSVHSMMGPSPGPPSVSHPMPTM
GSTDFPQEGMHQMHKPIDGIHDKGIVEDIHCGSMKGTGMRPPHPGMGPPQSPMDQHSQGY
MSPHPSPLGAPEHVSSPMSGGGPTPPQMPPSQPGALIPGDPQAMSQPNRGPSPFSPVQLH
QLRAQILAYKMLARGQPLPETLQLAVQGKRTLPGLQQQQQQQQQQQQQQQQQQQQQQQPQ
QQPPQPQTQQQQQPALVNYNRPSGPGPELSGPSTPQKLPVPAPGGRPSPAPPAAAQPPAA
AVPGPSVPQPAPGQPSPVLQLQQKQSRISPIQKPQGLDPVEILQEREYRLQARIAHRIQE
LENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMRRDTTLETALNSKAYKRSKR
QTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKDFKEYHRSVAGKIQKLSKAV
ATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQKKDRRLAYLLQQTDEYVANL
TNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGESALGPDGEPIDESSQMSDLPVKVTHT
ETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESDSDYEEEDEEEESSRQETEEKI
LLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSYYTVAHAISERVEKQSALLI
NGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIV
PLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHIL
AKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLP
TIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPE
KVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPY
MFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMT
IMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADT
VVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQ
AGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQMIARREEEFDLFMRMDMDR
RREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKIFGRGSRQRRDVDYSDAL
TEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDVEKAKKRRGRPPAEKLSPNP
PKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGRQLSEVFIQLPSRKELPEYY
ELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTFNLEGSQIYEDSIVLQSVFK
SARQKIAKEEESEDESNEEEEEEDEEESESEAKSVKVKIKLNKKDDKGRDKGKGKKRPNR
GKAKPVVSDFDSDEEQDEREQSEGSGTDDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IJ25	0.639	0.634	0.000	1604	0.816	0.809	A0A0R4IJ25.pdb.gz
2	AFDB:E9PTG1	0.667	0.664	0.000	1597	0.970	0.966	E9PTG1.pdb.gz	E9PTG1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
3	AFDB:P51532	0.593	0.573	0.000	1647	0.782	0.755	P51532.pdb.gz	SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2
4	AFDB:Q3TKT4	0.584	0.576	0.000	1613	0.779	0.768	Q3TKT4.pdb.gz	SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1
5	AFDB:Q6DIC0	0.668	0.673	0.000	1577	0.957	0.964	Q6DIC0.pdb.gz	SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1
6	PDB:6tdaS	0.313	0.619	1.506E-52	783	0.235	0.476	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
7	PDB:6uxwA	0.357	0.706	3.750E-52	778	0.243	0.497	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
8	AFDB:F4IV99	0.299	0.277	2.084E-50	1724	0.184	0.170	F4IV99.pdb.gz	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
9	PDB:6kw3Y	0.315	0.880	1.295E-45	548	0.209	0.606	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
10	PDB:6jylK	0.279	0.850	6.608E-43	504	0.145	0.458	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
11	PDB:6ltjI	0.213	0.530	7.529E-42	551	0.323	0.931	6ltjI.pdb.gz	Structure of nucleosome-bound human BAF complex.
12	PDB:6g0lM	0.260	0.477	3.254E-36	855	0.149	0.277	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
13	PDB:6g0lW	0.265	0.471	1.000E-33	878	0.149	0.270	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
14	PDB:7epuB	0.193	0.350	1.892E-32	748	0.136	0.290	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
15	PDB:7oo3b	0.265	0.753	1.892E-32	534	0.101	0.301	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
16	AFDB:Q9GQN5	0.278	0.334	4.916E-31	1311	0.161	0.195	Q9GQN5.pdb.gz	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
17	PDB:6gejM	0.249	0.557	8.053E-31	688	0.128	0.295	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
18	AFDB:A0A2R8RUE4	0.182	0.200	3.104E-12	1439	0.116	0.128	A0A2R8RUE4.pdb.gz
19	AFDB:Q9VGI8	0.169	0.179	1.884E-10	1487	0.125	0.134	Q9VGI8.pdb.gz	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
20	AFDB:Q22308	0.164	0.241	6.888E-9	1022	0.094	0.146	Q22308.pdb.gz	Q22308_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-19 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUS4	2805	1488	0.857	0.915	A0A0G2JUS4_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=2
2	A0A1D8PGK4	731	1690	0.226	0.213	A0A1D8PGK4_CANAL SWI/SNF catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF2 PE=4 SV=1
3	A0A1D8PJG4	797	1302	0.264	0.323	A0A1D8PJG4_CANAL RSC chromatin remodeling complex ATPase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STH1 PE=4 SV=1
4	A0A2R8Y440	1801	1192	0.611	0.815	A0A2R8Y440_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
5	A0A2R8Y4P4	1951	1649	0.665	0.642	A0A2R8Y4P4_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
6	A0A2R8Y523	1117	799	0.373	0.742	A0A2R8Y523_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
7	A0A2R8Y526	1501	1068	0.519	0.772	A0A2R8Y526_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
8	A0A2R8Y5K3	614	522	0.224	0.682	A0A2R8Y5K3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
9	A0A2R8Y6N0	1668	1145	0.565	0.784	A0A2R8Y6N0_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
10	A0A2R8Y6V2	1479	1041	0.497	0.759	A0A2R8Y6V2_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
11	A0A2R8Y7F3	1716	1165	0.578	0.789	A0A2R8Y7F3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
12	A0A2R8Y7S2	1951	1646	0.665	0.643	A0A2R8Y7S2_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
13	A0A2R8Y7Y7	1562	1081	0.516	0.759	A0A2R8Y7Y7_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
14	A0A2R8YF58	1574	1065	0.539	0.805	A0A2R8YF58_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
15	A0A2R8YF80	1551	1094	0.531	0.771	A0A2R8YF80_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
16	A0A2R8YG32	1768	1198	0.596	0.791	A0A2R8YG32_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
17	A0A2R8YGG3	1983	1455	0.672	0.735	A0A2R8YGG3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
18	A0A8I6ARN7	3124	1579	0.960	0.967	A0A8I6ARN7_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
19	A7E2E1	1984	1647	0.671	0.648	A7E2E1_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=2 SV=1
20	E9PTG1	3170	1597	0.971	0.967	E9PTG1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07533 BRK	1.6e-14	64.5	BRK domain
2	PF00439 Bromodomain	1.3e-17	75.0	Bromodomain
3	PF00271 Helicase_C	1.5e-16	72.1	Helicase conserved C-terminal domain
4	PF07529 HSA	4.4e-16	70.2	HSA domain
5	PF08880 QLQ	5.8e-10	50.0	QLQ
6	PF04851 ResIII	4.6e-05	35.0	Type III restriction enzyme, res subunit
7	PF14619 SnAC	2.4e-15	68.2	Snf2-ATP coupling, chromatin remodelling complex
8	PF00176 SNF2-rel_dom	9.3e-73	256.5	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265773

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254480	0.999	SWI/SNF complex subunit SMARCC1
2	9606.ENSP00000263121	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
3	9606.ENSP00000267064	0.999	SWI/SNF complex subunit SMARCC2
4	9606.ENSP00000320485	0.999	AT-rich interactive domain-containing protein 1A
5	9606.ENSP00000323967	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
6	9606.ENSP00000397552	0.999	Actin-like protein 6A
7	9606.ENSP00000262188	0.998	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
8	9606.ENSP00000344546	0.998	AT-rich interactive domain-containing protein 1B
9	9606.ENSP00000378414	0.998	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
10	9606.ENSP00000392617	0.998	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
11	9606.ENSP00000335044	0.995	AT-rich interactive domain-containing protein 2
12	9606.ENSP00000414516	0.994	Protein SSXT
13	9606.ENSP00000395654	0.987	Transcription activator BRG1
14	9606.ENSP00000419765	0.987	Bromodomain-containing protein 9
15	9606.ENSP00000160382	0.986	Actin-like protein 6B
16	9606.ENSP00000305422	0.985	CCAAT/enhancer-binding protein beta
17	9606.ENSP00000479526	0.984	Zinc finger protein DPF3
18	9606.ENSP00000341805	0.982	PHD finger protein 10
19	9606.ENSP00000436901	0.977	Zinc finger protein ubi-d4
20	9606.ENSP00000480158	0.970	DNA-directed RNA polymerase II subunit RPB1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.999	chromatin binding
GO:1901363	0.973	heterocyclic compound binding
GO:0097159	0.973	organic cyclic compound binding
GO:0003676	0.960	nucleic acid binding
GO:0000976	0.953	transcription cis-regulatory region binding
GO:0003824	0.909	catalytic activity
GO:0140657	0.756	ATP-dependent activity
GO:0140110	0.690	transcription regulator activity
GO:0008134	0.683	transcription factor binding
GO:0140297	0.665	DNA-binding transcription factor binding
GO:0003712	0.615	transcription coregulator activity
GO:0140640	0.554	catalytic activity, acting on a nucleic acid
GO:0140097	0.387	catalytic activity, acting on DNA
GO:0008094	0.365	ATP-dependent activity, acting on DNA
GO:0044877	0.334	protein-containing complex binding
GO:0042393	0.315	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0050789	0.951	regulation of biological process
GO:0060255	0.905	regulation of macromolecule metabolic process
GO:0071840	0.847	cellular component organization or biogenesis
GO:0016043	0.833	cellular component organization
GO:0010468	0.832	regulation of gene expression
GO:0032501	0.821	multicellular organismal process
GO:0032502	0.808	developmental process
GO:0048856	0.785	anatomical structure development
GO:0048519	0.745	negative regulation of biological process
GO:0006325	0.744	chromatin organization
GO:0006338	0.712	chromatin remodeling
GO:0050794	0.692	regulation of cellular process
GO:0031323	0.619	regulation of cellular metabolic process
GO:0080090	0.598	regulation of primary metabolic process
GO:0051171	0.598	regulation of nitrogen compound metabolic process
GO:0019219	0.569	regulation of nucleobase-containing compound metabolic process
GO:0007286	0.552	spermatid development
GO:0009889	0.521	regulation of biosynthetic process
GO:0010556	0.508	regulation of macromolecule biosynthetic process
GO:0031326	0.508	regulation of cellular biosynthetic process
GO:0051252	0.508	regulation of RNA metabolic process
GO:2001141	0.502	regulation of RNA biosynthetic process
GO:0006355	0.493	regulation of DNA-templated transcription
GO:0048518	0.400	positive regulation of biological process
GO:0009892	0.400	negative regulation of metabolic process
GO:0048522	0.367	positive regulation of cellular process
GO:0010605	0.367	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0000785	0.994	chromatin
GO:0140513	0.994	nuclear protein-containing complex
GO:1902494	0.992	catalytic complex
GO:0070603	0.982	SWI/SNF superfamily-type complex
GO:0016514	0.960	SWI/SNF complex
GO:0005730	0.541	nucleolus
GO:0071564	0.383	npBAF complex
GO:0005856	0.353	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]