StarFunc result for job id P51532

User Input

>input (1647 residues)
MSTPDPPLGGTPRPGPSPGPGPSPGAMLGPSPGPSPGSAHSMMGPSPGPPSAGHPIPTQG
PGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGY
PSPLGGSEHASSPVPASGPSSGPQMSSGPGGAPLDGADPQALGQQNRGPTPFNQNQLHQL
RAQIMAYKMLARGQPLPDHLQMAVQGKRPMPGMQQQMPTLPPPSVSATGPGPGPGPGPGP
GPGPAPPNYSRPHGMGGPNMPPPGPSGVPPGMPGQPPGGPPKPWPEGPMANAAAPTSTPQ
KLIPPQPTGRPSPAPPAVPPAASPVMPPQTQSPGQPAQPAPMVPLHQKQSRITPIQKPRG
LDPVEILQEREYRLQARIAHRIQELENLPGSLAGDLRTKATIELKALRLLNFQRQLRQEV
VVCMRRDTALETALNAKAYKRSKRQSLREARITEKLEKQQKIEQERKRRQKHQEYLNSIL
QHAKDFKEYHRSVTGKIQKLTKAVATYHANTEREQKKENERIEKERMRRLMAEDEEGYRK
LIDQKKDKRLAYLLQQTDEYVANLTELVRQHKAAQVAKEKKKKKKKKKAENAEGQTPAIG
PDGEPLDETSQMSDLPVKVIHVESGKILTGTDAPKAGQLEAWLEMNPGYEVAPRSDSEES
GSEEEEEEEEEEQPQAAQPPTLPVEEKKKIPDPDSDDVSEVDARHIIENAKQDVDDEYGV
SQALARGLQSYYAVAHAVTERVDKQSALMVNGVLKQYQIKGLEWLVSLYNNNLNGILADE
MGLGKTIQTIALITYLMEHKRINGPFLIIVPLSTLSNWAYEFDKWAPSVVKVSYKGSPAA
RRAFVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTH
YVAPRRLLLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGEKVDLNEEE
TILIIRRLHKVLRPFLLRRLKKEVEAQLPEKVEYVIKCDMSALQRVLYRHMQAKGVLLTD
GSEKDKKGKGGTKTLMNTIMQLRKICNHPYMFQHIEESFSEHLGFTGGIVQGLDLYRASG
KFELLDRILPKLRATNHKVLLFCQMTSLMTIMEDYFAYRGFKYLRLDGTTKAEDRGMLLK
TFNEPGSEYFIFLLSTRAGGLGLNLQSADTVIIFDSDWNPHQDLQAQDRAHRIGQQNEVR
VLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEQDESR
HCSTGSGSASFAHTAPPPAGVNPDLEEPPLKEEDEVPDDETVNQMIARHEEEFDLFMRMD
LDRRREEARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEEKMFGRGSRHRKEVDYS
DSLTEKQWLKAIEEGTLEEIEEEVRQKKSSRKRKRDSDAGSSTPTTSTRSRDKDDESKKQ
KKRGRPPAEKLSPNPPNLTKKMKKIVDAVIKYKDSSSGRQLSEVFIQLPSRKELPEYYEL
IRKPVDFKKIKERIRNHKYRSLNDLEKDVMLLCQNAQTFNLEGSLIYEDSIVLQSVFTSV
RQKIEKEDDSEGEESEEEEEGEEEGSESESRSVKVKIKLGRKEKAQDRLKGGRRRPSRGS
RAKPVVSDDDSEEEQEEDRSGSGSEED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IJ25	0.567	0.582	0.000	1604	0.734	0.754	A0A0R4IJ25.pdb.gz
2	AFDB:E9PTG1	0.588	0.606	0.000	1597	0.746	0.770	E9PTG1.pdb.gz	E9PTG1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
3	AFDB:P51532	0.999	0.999	0.000	1647	1.000	1.000	P51532.pdb.gz	SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2
4	AFDB:Q3TKT4	0.574	0.585	0.000	1613	0.972	0.993	Q3TKT4.pdb.gz	SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1
5	AFDB:Q6DIC0	0.575	0.599	0.000	1577	0.749	0.782	Q6DIC0.pdb.gz	SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1
6	AFDB:Q7ZSY3	0.586	0.592	0.000	1627	0.878	0.889	Q7ZSY3.pdb.gz	Q7ZSY3_DANRE Brahma protein-like protein 1 OS=Danio rerio OX=7955 GN=smarca4 PE=1 SV=1
7	AFDB:Q6EVK6	0.372	0.282	7.902E-70	2193	0.284	0.213	Q6EVK6.pdb.gz	BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana OX=3702 GN=BRM PE=1 SV=1
8	PDB:6uxwA	0.347	0.713	9.055E-52	778	0.235	0.497	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
9	AFDB:F4IV99	0.282	0.270	5.420E-51	1724	0.219	0.209	F4IV99.pdb.gz	CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana OX=3702 GN=CHR5 PE=1 SV=1
10	PDB:6tdaS	0.286	0.586	2.006E-50	783	0.217	0.457	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
11	AFDB:Q54Q16	0.277	0.238	3.547E-47	1917	0.215	0.185	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
12	AFDB:Q09XV5	0.273	0.177	1.626E-43	2582	0.231	0.148	Q09XV5.pdb.gz	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
13	PDB:6kw3Y	0.305	0.883	1.871E-43	548	0.200	0.600	6kw3Y.pdb.gz	Structure of the RSC complex bound to the nucleosome.
14	PDB:6jylK	0.271	0.853	1.840E-42	504	0.141	0.460	6jylK.pdb.gz	Structures of the ISWI-nucleosome complex reveal a conserved mechanism of chromatin remodeling.
15	PDB:6ltjI	0.206	0.530	1.088E-41	551	0.333	0.995	6ltjI.pdb.gz	Structure of nucleosome-bound human BAF complex.
16	PDB:6g0lM	0.251	0.477	3.677E-35	855	0.128	0.247	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
17	PDB:7oo3b	0.253	0.741	3.932E-33	534	0.099	0.305	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
18	PDB:7epuB	0.186	0.344	2.406E-31	748	0.133	0.293	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
19	PDB:6g0lW	0.255	0.471	3.101E-31	878	0.139	0.261	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
20	PDB:6gejM	0.238	0.552	4.064E-29	688	0.125	0.299	6gejM.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JUS4	1977	1488	0.640	0.708	A0A0G2JUS4_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=2
2	A0A1D8PGK4	731	1690	0.220	0.215	A0A1D8PGK4_CANAL SWI/SNF catalytic subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF2 PE=4 SV=1
3	A0A1D8PJG4	791	1302	0.251	0.317	A0A1D8PJG4_CANAL RSC chromatin remodeling complex ATPase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STH1 PE=4 SV=1
4	A0A2R8Y440	2415	1192	0.721	0.997	A0A2R8Y440_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
5	A0A2R8Y4P4	3280	1649	0.980	0.979	A0A2R8Y4P4_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
6	A0A2R8Y523	1565	799	0.465	0.959	A0A2R8Y523_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
7	A0A2R8Y526	2170	1068	0.646	0.996	A0A2R8Y526_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
8	A0A2R8Y5K3	978	522	0.295	0.931	A0A2R8Y5K3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
9	A0A2R8Y6N0	2347	1145	0.693	0.997	A0A2R8Y6N0_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
10	A0A2R8Y6V2	2120	1041	0.631	0.999	A0A2R8Y6V2_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
11	A0A2R8Y7F3	2398	1165	0.707	1.000	A0A2R8Y7F3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
12	A0A2R8Y7S2	3280	1646	0.980	0.981	A0A2R8Y7S2_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
13	A0A2R8Y7Y7	2225	1081	0.656	0.999	A0A2R8Y7Y7_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
14	A0A2R8YF58	2176	1065	0.647	1.000	A0A2R8YF58_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
15	A0A2R8YF80	2154	1094	0.644	0.970	A0A2R8YF80_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
16	A0A2R8YFK5	613	336	0.202	0.988	A0A2R8YFK5_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
17	A0A2R8YG32	2453	1198	0.725	0.997	A0A2R8YG32_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
18	A0A2R8YGG3	2972	1455	0.881	0.997	A0A2R8YGG3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
19	A0A8I6ARN7	2185	1579	0.718	0.749	A0A8I6ARN7_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1
20	A7E2E1	3386	1647	1.000	1.000	A7E2E1_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07533 BRK	3.3e-14	63.5	BRK domain
2	PF00439 Bromodomain	8.7e-17	72.3	Bromodomain
3	PF00270 DEAD	2.6	19.3	DEAD/DEAH box helicase
4	PF09418 DUF2009	6.2e+02	10.8	Protein of unknown function (DUF2009)
5	PF00271 Helicase_C	2.9e-18	77.6	Helicase conserved C-terminal domain
6	PF07529 HSA	6e-16	69.8	HSA domain
7	PF08880 QLQ	2.7e-11	54.3	QLQ
8	PF04851 ResIII	3.7e-06	38.5	Type III restriction enzyme, res subunit
9	PF14619 SnAC	1.1e-16	72.4	Snf2-ATP coupling, chromatin remodelling complex
10	PF00176 SNF2-rel_dom	8.9e-74	259.8	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395654

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254480	0.999	SWI/SNF complex subunit SMARCC1
2	9606.ENSP00000262188	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
3	9606.ENSP00000263121	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
4	9606.ENSP00000267064	0.999	SWI/SNF complex subunit SMARCC2
5	9606.ENSP00000309572	0.999	Telomerase reverse transcriptase
6	9606.ENSP00000320485	0.999	AT-rich interactive domain-containing protein 1A
7	9606.ENSP00000323967	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
8	9606.ENSP00000335044	0.999	AT-rich interactive domain-containing protein 2
9	9606.ENSP00000344456	0.999	Catenin beta-1
10	9606.ENSP00000344546	0.999	AT-rich interactive domain-containing protein 1B
11	9606.ENSP00000349960	0.999	Actin, cytoplasmic 1
12	9606.ENSP00000362649	0.999	Histone deacetylase 1
13	9606.ENSP00000378414	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
14	9606.ENSP00000392617	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
15	9606.ENSP00000397552	0.999	Actin-like protein 6A
16	9606.ENSP00000231509	0.998	Glucocorticoid receptor
17	9606.ENSP00000436901	0.998	Zinc finger protein ubi-d4
18	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
19	9606.ENSP00000319169	0.997	Protein arginine N-methyltransferase 5
20	9606.ENSP00000414516	0.997	Protein SSXT

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.993	protein binding
GO:0003682	0.993	chromatin binding
GO:0003676	0.986	nucleic acid binding
GO:0003677	0.984	DNA binding
GO:0003824	0.977	catalytic activity
GO:0019899	0.942	enzyme binding
GO:1990837	0.935	sequence-specific double-stranded DNA binding
GO:0140657	0.917	ATP-dependent activity
GO:0140110	0.898	transcription regulator activity
GO:0001067	0.881	transcription regulatory region nucleic acid binding
GO:0008134	0.877	transcription factor binding
GO:0140297	0.857	DNA-binding transcription factor binding
GO:0000976	0.845	transcription cis-regulatory region binding
GO:0044877	0.837	protein-containing complex binding
GO:0003712	0.812	transcription coregulator activity
GO:0004386	0.726	helicase activity
GO:0001221	0.721	transcription coregulator binding
GO:0070577	0.713	lysine-acetylated histone binding
GO:0008094	0.700	ATP-dependent activity, acting on DNA
GO:0070182	0.607	DNA polymerase binding
GO:0003713	0.429	transcription coactivator activity
GO:0031492	0.377	nucleosomal DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010468	0.991	regulation of gene expression
GO:0009987	0.989	cellular process
GO:0048519	0.970	negative regulation of biological process
GO:0050794	0.928	regulation of cellular process
GO:0032502	0.904	developmental process
GO:0032501	0.904	multicellular organismal process
GO:0016043	0.886	cellular component organization
GO:0080090	0.856	regulation of primary metabolic process
GO:0051171	0.856	regulation of nitrogen compound metabolic process
GO:0031323	0.856	regulation of cellular metabolic process
GO:0006338	0.853	chromatin remodeling
GO:0019219	0.842	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.800	positive regulation of biological process
GO:0010605	0.748	negative regulation of macromolecule metabolic process
GO:2001141	0.747	regulation of RNA biosynthetic process
GO:0006355	0.738	regulation of DNA-templated transcription
GO:0048856	0.680	anatomical structure development
GO:0048522	0.632	positive regulation of cellular process
GO:0010604	0.571	positive regulation of macromolecule metabolic process
GO:0048523	0.568	negative regulation of cellular process
GO:0051173	0.558	positive regulation of nitrogen compound metabolic process
GO:0031325	0.549	positive regulation of cellular metabolic process
GO:0051172	0.463	negative regulation of nitrogen compound metabolic process
GO:0031324	0.462	negative regulation of cellular metabolic process
GO:0006357	0.453	regulation of transcription by RNA polymerase II
GO:0045935	0.447	positive regulation of nucleobase-containing compound metabolic process
GO:0045934	0.435	negative regulation of nucleobase-containing compound metabolic process
GO:0045893	0.427	positive regulation of DNA-templated transcription
GO:0008152	0.395	metabolic process
GO:0071704	0.393	organic substance metabolic process
GO:0045892	0.379	negative regulation of DNA-templated transcription
GO:0044238	0.348	primary metabolic process
GO:0048583	0.329	regulation of response to stimulus
GO:0006807	0.323	nitrogen compound metabolic process
GO:0043170	0.314	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005730	0.987	nucleolus
GO:0001650	0.977	fibrillar center
GO:0032991	0.976	protein-containing complex
GO:0000785	0.919	chromatin
GO:0140513	0.916	nuclear protein-containing complex
GO:1902494	0.915	catalytic complex
GO:0070603	0.503	SWI/SNF superfamily-type complex
GO:0071564	0.382	npBAF complex
GO:0016514	0.369	SWI/SNF complex
GO:0005737	0.347	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]