StarFunc result for job id P51553

User Input

>input (393 residues)
MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAKYGGRHTVTMI
PGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIET
NHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHE
SVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVA
ARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG
HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNEN
MHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41565	0.904	0.904	5.743E-78	393	0.957	0.957	P41565.pdb.gz	IDHG1_RAT Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3g PE=1 SV=2
2	PDB:7ce3B	0.866	0.985	4.371E-63	345	0.875	0.997	7ce3B.pdb.gz
3	AFDB:Q8BPC6	0.881	0.874	1.606E-62	396	0.634	0.629	Q8BPC6.pdb.gz	IDHG2_MOUSE Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Mus musculus OX=10090 PE=2 SV=1
4	AFDB:A0A087WZN1	0.837	0.850	3.694E-49	387	0.486	0.494	A0A087WZN1.pdb.gz	A0A087WZN1_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1
5	AFDB:P28834	0.833	0.908	3.956E-48	360	0.430	0.469	P28834.pdb.gz	IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDH1 PE=1 SV=2
6	AFDB:O13696	0.842	0.928	3.562E-47	356	0.425	0.469	O13696.pdb.gz	IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idh1 PE=1 SV=1
7	AFDB:Q9VD58	0.809	0.859	2.019E-46	370	0.453	0.481	Q9VD58.pdb.gz	Q9VD58_DROME GH26270p OS=Drosophila melanogaster OX=7227 GN=Idh3b PE=1 SV=1
8	AFDB:Q54B68	0.791	0.863	5.456E-45	360	0.450	0.492	Q54B68.pdb.gz	IDHB_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=idhB PE=3 SV=1
9	AFDB:Q8LFC0	0.801	0.857	6.876E-45	367	0.433	0.463	Q8LFC0.pdb.gz	IDH1_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH1 PE=1 SV=2
10	AFDB:P93032	0.807	0.863	1.545E-44	367	0.422	0.452	P93032.pdb.gz	IDH2_ARATH Isocitrate dehydrogenase [NAD] regulatory subunit 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH2 PE=1 SV=2
11	AFDB:Q8LG77	0.810	0.851	1.947E-44	374	0.427	0.449	Q8LG77.pdb.gz	IDH6_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH6 PE=1 SV=2
12	PDB:3blvC	0.819	0.934	1.148E-42	344	0.425	0.485	3blvC.pdb.gz	Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
13	PDB:6kdfE	0.775	0.895	1.346E-38	338	0.377	0.438	6kdfE.pdb.gz
14	PDB:4yb4A	0.774	0.910	1.168E-35	333	0.313	0.369	4yb4A.pdb.gz	Structure of homoisocitrate dehydrogenase from Thermus thermophilus in complex with homoisocitrate, magnesium(II) and NADH
15	PDB:3blvH	0.752	0.845	1.987E-34	348	0.341	0.385	3blvH.pdb.gz	Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
16	PDB:3ty3A	0.762	0.833	1.036E-30	358	0.280	0.307	3ty3A.pdb.gz	Crystal structure of homoisocitrate dehydrogenase from Schizosaccharomyces pombe.
17	PDB:4aj3A	0.760	0.719	2.770E-30	416	0.242	0.228	4aj3A.pdb.gz	Induced Fit and the Catalytic Mechanism of Isocitrate Dehydrogenase.
18	PDB:1hqsA	0.779	0.725	5.874E-30	423	0.254	0.236	1hqsA.pdb.gz
19	PDB:2g4oD	0.738	0.855	1.664E-29	337	0.229	0.267	2g4oD.pdb.gz	On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
20	PDB:5j32A	0.746	0.792	1.604E-27	369	0.260	0.276	5j32A.pdb.gz	Structure and Mechanism of Isopropylmalate Dehydrogenase from Arabidopsis thaliana: INSIGHTS ON LEUCINE AND ALIPHATIC GLUCOSINOLATE BIOSYNTHESIS.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EQB8	0.0	705	340	0.865	1.000	E7EQB8_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1
2	E9PF84	0.0	585	285	0.715	0.986	E9PF84_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1
3	G5E9Q7	0.0	626	322	0.771	0.941	G5E9Q7_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1
4	P41565	0.0	768	393	0.957	0.957	IDHG1_RAT Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3g PE=1 SV=2
5	P51553	0.0	813	393	1.000	1.000	IDH3G_HUMAN Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1
6	P70404	0.0	763	393	0.952	0.952	IDHG1_MOUSE Isocitrate dehydrogenase [NAD] subunit gamma 1, mitochondrial OS=Mus musculus OX=10090 GN=Idh3g PE=1 SV=1
7	Q8BPC6	0.0	532	396	0.641	0.636	IDHG2_MOUSE Probable isocitrate dehydrogenase [NAD] gamma 2, mitochondrial OS=Mus musculus OX=10090 PE=2 SV=1
8	O43837	1.33e-124	367	385	0.466	0.475	IDH3B_HUMAN Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=2
9	A0A087WZN1	1.46e-124	366	387	0.466	0.473	A0A087WZN1_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1
10	Q91VA7	2.31e-124	366	384	0.473	0.484	Q91VA7_MOUSE Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Mus musculus OX=10090 GN=Idh3b PE=1 SV=1
11	Q68FX0	6.12e-123	362	385	0.463	0.473	IDH3B_RAT Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial OS=Rattus norvegicus OX=10116 GN=Idh3B PE=2 SV=1
12	A0A668KL51	1.24e-121	358	380	0.466	0.482	A0A668KL51_MOUSE Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Mus musculus OX=10090 GN=Idh3b PE=1 SV=1
13	A0A087X2E5	1.13e-118	351	376	0.440	0.460	A0A087X2E5_HUMAN Isocitrate dehydrogenase [NAD] subunit, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3B PE=1 SV=1
14	P28834	3.53e-117	347	360	0.433	0.472	IDH1_YEAST Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IDH1 PE=1 SV=2
15	H7C1W2	3.04e-115	335	199	0.433	0.854	H7C1W2_HUMAN Isocitrate dehydrogenase (NAD(+)) 3 non-catalytic subunit gamma (Fragment) OS=Homo sapiens OX=9606 GN=IDH3G PE=1 SV=1
16	O13696	1.58e-113	337	356	0.425	0.469	IDH1_SCHPO Isocitrate dehydrogenase [NAD] subunit 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=idh1 PE=1 SV=1
17	Q9VD58	1.78e-111	332	370	0.461	0.489	Q9VD58_DROME GH26270p OS=Drosophila melanogaster OX=7227 GN=Idh3b PE=1 SV=1
18	Q945K7	1.01e-110	331	374	0.417	0.439	IDH5_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 5, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH5 PE=1 SV=1
19	Q54B68	1.06e-109	328	360	0.438	0.478	IDHB_DICDI Isocitrate dehydrogenase [NAD] regulatory subunit B, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=idhB PE=3 SV=1
20	Q8LG77	1.80e-106	320	374	0.425	0.447	IDH6_ARATH Isocitrate dehydrogenase [NAD] catalytic subunit 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IDH6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00180 Iso_dh	3.7e-70	248.5	Isocitrate/isopropylmalate dehydrogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217901

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299518	0.999	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
2	9606.ENSP00000216254	0.998	Aconitate hydratase, mitochondrial
3	9606.ENSP00000331897	0.997	Isocitrate dehydrogenase [NADP], mitochondrial
4	9606.ENSP00000342056	0.996	Citrate synthase, mitochondrial
5	9606.ENSP00000370223	0.995	Isocitrate dehydrogenase [NAD] subunit beta, mitochondrial
6	9606.ENSP00000390265	0.994	Isocitrate dehydrogenase 1, cytosolic
7	9606.ENSP00000222673	0.981	2-oxoglutarate dehydrogenase, mitochondrial
8	9606.ENSP00000262030	0.978	ATP synthase subunit beta, mitochondrial
9	9606.ENSP00000377446	0.977	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
10	9606.ENSP00000363216	0.972	2-oxoglutarate dehydrogenase-like, mitochondrial
11	9606.ENSP00000381736	0.967	ATP synthase subunit alpha, mitochondrial
12	9606.ENSP00000309477	0.966	Cytoplasmic aconitate hydratase
13	9606.ENSP00000317159	0.965	Cytochrome c1, heme protein, mitochondrial
14	9606.ENSP00000327070	0.957	Malate dehydrogenase, mitochondrial
15	9606.ENSP00000364649	0.951	Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
16	9606.ENSP00000281456	0.932	ADP/ATP translocase 1
17	9606.ENSP00000377033	0.927	ATP synthase F(0) complex subunit C1, mitochondrial
18	9606.ENSP00000373620	0.918	60 kDa heat shock protein, mitochondrial
19	9606.ENSP00000264932	0.917	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
20	9606.ENSP00000438204	0.915	Mitochondrial import receptor subunit TOM5 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004449	1.000	isocitrate dehydrogenase (NAD+) activity
GO:0005488	0.998	binding
GO:0005515	0.990	protein binding
GO:0043167	0.880	ion binding
GO:0046872	0.553	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006099	0.992	tricarboxylic acid cycle
GO:0071704	0.959	organic substance metabolic process
GO:0044281	0.839	small molecule metabolic process
GO:0019752	0.793	carboxylic acid metabolic process
GO:0006807	0.556	nitrogen compound metabolic process
GO:1901564	0.401	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005634	0.991	nucleus
GO:0032991	0.953	protein-containing complex
GO:0098798	0.936	mitochondrial protein-containing complex
GO:1990204	0.918	oxidoreductase complex
GO:0005759	0.849	mitochondrial matrix
GO:0031981	0.643	nuclear lumen
GO:0045239	0.566	tricarboxylic acid cycle enzyme complex
GO:0043232	0.556	intracellular non-membrane-bounded organelle
GO:0016020	0.383	membrane
GO:0030062	0.305	mitochondrial tricarboxylic acid cycle enzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23632	1.000	D-threo-isocitrate + NAD(+) = 2-oxoglutarate + CO2 + NADH
EC:1.1.1.41	1.000	isocitrate dehydrogenase (NAD(+)).

[back to server]