StarFunc result for job id P51572

User Input

>input (246 residues)
MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILV
LLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLV
TLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEE
NRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGP
MDKKEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51572	1.000	1.000	1.094E-31	246	1.000	1.000	P51572.pdb.gz	BAP31_HUMAN B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3
2	AFDB:Q9UHQ4	0.631	0.644	2.652E-16	241	0.476	0.485	Q9UHQ4.pdb.gz	BAP29_HUMAN B-cell receptor-associated protein 29 OS=Homo sapiens OX=9606 GN=BCAP29 PE=1 SV=2
3	AFDB:Q61334	0.644	0.659	2.971E-16	240	0.472	0.483	Q61334.pdb.gz	BAP29_MOUSE B-cell receptor-associated protein 29 OS=Mus musculus OX=10090 GN=Bcap29 PE=1 SV=1
4	AFDB:Q9W0M4	0.611	0.658	9.269E-14	228	0.382	0.412	Q9W0M4.pdb.gz	Q9W0M4_DROME Endoplasmic reticulum transmembrane protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13887 PE=1 SV=1
5	AFDB:G5EBI0	0.619	0.711	6.593E-12	213	0.341	0.394	G5EBI0.pdb.gz	G5EBI0_CAEEL Endoplasmic reticulum transmembrane protein OS=Caenorhabditis elegans OX=6239 GN=4D656 PE=1 SV=1
6	AFDB:A0A1D8PGL1	0.425	0.542	6.420E-5	189	0.199	0.259	A0A1D8PGL1.pdb.gz	A0A1D8PGL1_CANAL Endoplasmic reticulum transmembrane protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C202410WA PE=3 SV=1
7	AFDB:Q93XZ7	0.388	0.433	8.060E-5	218	0.252	0.284	Q93XZ7.pdb.gz	Q93XZ7_ARATH Endoplasmic reticulum transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At5g42570 PE=1 SV=1
8	AFDB:Q07451	0.401	0.465	2.513E-4	203	0.203	0.246	Q07451.pdb.gz	YET3_YEAST Endoplasmic reticulum transmembrane protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YET3 PE=1 SV=1
9	AFDB:O14290	0.565	0.721	2.981E-4	188	0.167	0.218	O14290.pdb.gz	YF14_SCHPO Uncharacterized protein C9E9.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9E9.04 PE=4 SV=1
10	AFDB:Q59UQ1	0.405	0.524	4.192E-4	186	0.195	0.258	Q59UQ1.pdb.gz	Q59UQ1_CANAL Endoplasmic reticulum transmembrane protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C400410WA PE=3 SV=1
11	PDB:6so5C	0.247	0.395	4.388E-1	144	0.073	0.125	6so5C.pdb.gz	Structural Basis of Tail-Anchored Membrane Protein Biogenesis by the GET Insertase Complex.
12	PDB:6tz402	0.218	0.279	5.508E-1	176	0.106	0.148	6tz402.pdb.gz
13	PDB:5ew5A	0.272	0.156	5.830E-1	490	0.061	0.031	5ew5A.pdb.gz
14	PDB:2b5uA	0.279	0.165	6.172E-1	470	0.065	0.034	2b5uA.pdb.gz
15	PDB:4q4aA	0.235	0.121	6.915E-1	572	0.085	0.037	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
16	PDB:5mkkA	0.199	0.103	7.319E-1	593	0.089	0.037	5mkkA.pdb.gz
17	PDB:7nsuD	0.263	0.173	9.726E-1	420	0.061	0.036	7nsuD.pdb.gz
18	PDB:4i9qB	0.202	0.064	1.292	873	0.053	0.015	4i9qB.pdb.gz	A Remote Palm Domain Residue of RB69 DNA Polymerase Is Critical for Enzyme Activity and Influences the Conformation of the Active Site.
19	PDB:6qnxA	0.243	0.075	1.292	928	0.053	0.014	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
20	PDB:5bw9g	0.280	0.430	1.448	141	0.073	0.128	5bw9g.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51572	1.68e-180	496	246	1.000	1.000	BAP31_HUMAN B-cell receptor-associated protein 31 OS=Homo sapiens OX=9606 GN=BCAP31 PE=1 SV=3
2	Q6AY58	1.46e-143	403	245	0.919	0.922	Q6AY58_RAT B-cell receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Bcap31 PE=3 SV=1
3	A0A0G2JXK2	8.66e-143	402	279	0.919	0.810	A0A0G2JXK2_RAT B-cell receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Bcap31 PE=1 SV=1
4	A5X380	2.97e-141	397	245	0.902	0.906	A5X380_MESAU B-cell receptor-associated protein OS=Mesocricetus auratus OX=10036 GN=Bcap31 PE=2 SV=1
5	Q61335	1.09e-140	396	245	0.907	0.910	BAP31_MOUSE B-cell receptor-associated protein 31 OS=Mus musculus OX=10090 GN=Bcap31 PE=1 SV=4
6	A0A8I5ZWB7	3.20e-136	385	246	0.882	0.882	A0A8I5ZWB7_RAT B-cell receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Bcap31 PE=1 SV=1
7	A0A8I5ZX74	1.01e-115	332	232	0.813	0.862	A0A8I5ZX74_RAT B-cell receptor-associated protein OS=Rattus norvegicus OX=10116 GN=Bcap31 PE=1 SV=1
8	Q9UHQ4	5.45e-68	211	241	0.480	0.490	BAP29_HUMAN B-cell receptor-associated protein 29 OS=Homo sapiens OX=9606 GN=BCAP29 PE=1 SV=2
9	Q61334	1.54e-65	205	240	0.484	0.496	BAP29_MOUSE B-cell receptor-associated protein 29 OS=Mus musculus OX=10090 GN=Bcap29 PE=1 SV=1
10	Q9W0M4	5.25e-45	152	228	0.386	0.417	Q9W0M4_DROME Endoplasmic reticulum transmembrane protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13887 PE=1 SV=1
11	G5EBI0	1.25e-42	145	213	0.341	0.394	G5EBI0_CAEEL Endoplasmic reticulum transmembrane protein OS=Caenorhabditis elegans OX=6239 GN=4D656 PE=1 SV=1
12	B9EQV3	9.94e-37	129	184	0.285	0.380	B9EQV3_DROME Endoplasmic reticulum transmembrane protein OS=Drosophila melanogaster OX=7227 GN=CG13887-RC PE=1 SV=1
13	Q07451	1.38e-12	66.6	203	0.256	0.310	YET3_YEAST Endoplasmic reticulum transmembrane protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YET3 PE=1 SV=1
14	Q93XZ7	5.85e-10	59.7	218	0.276	0.312	Q93XZ7_ARATH Endoplasmic reticulum transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At5g42570 PE=1 SV=1
15	A0A1D8PGL1	6.97e-05	44.7	189	0.163	0.212	A0A1D8PGL1_CANAL Endoplasmic reticulum transmembrane protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C202410WA PE=3 SV=1
16	Q8L702	0.001	41.2	221	0.122	0.136	Q8L702_ARATH Endoplasmic reticulum transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At1g11905 PE=1 SV=1
17	O14290	0.008	38.5	188	0.167	0.218	YF14_SCHPO Uncharacterized protein C9E9.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9E9.04 PE=4 SV=1
18	Q9VIQ9	0.018	38.5	2197	0.098	0.011	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
19	E9Q9R9	0.051	37.4	1921	0.118	0.015	DLG5_MOUSE Disks large homolog 5 OS=Mus musculus OX=10090 GN=Dlg5 PE=1 SV=1
20	A9Z0X3	0.20	35.4	753	0.089	0.029	A9Z0X3_GOSAR Homeodomain protein HOX1 OS=Gossypium arboreum OX=29729 GN=HOX1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10186 ATG14	1.3	19.6	Vacuolar sorting 38 and autophagy-related subunit 14
2	PF08614 ATG16	5.4	18.7	Autophagy protein 16 (ATG16)
3	PF05529 Bap31	8e-43	157.1	Bap31/Bap29 transmembrane region
4	PF18035 Bap31_Bap29_C	1.5e-12	58.6	Bap31/Bap29 cytoplasmic coiled-coil domain
5	PF08647 BRE1	28	16.2	BRE1 E3 ubiquitin ligase
6	PF12004 DUF3498	2.5e+02	12.3	Domain of unknown function (DUF3498)
7	PF12299 DUF3627	4.5e+02	12.3	Protein of unknown function (DUF3627)
8	PF13870 DUF4201	36	15.5	Domain of unknown function (DUF4201)
9	PF14362 DUF4407	7.7e+02	10.7	Domain of unknown function (DUF4407)
10	PF05325 DUF730	1.9e+02	13.5	Protein of unknown function (DUF730)
11	PF06195 DUF996	58	15.3	Protein of unknown function (DUF996)
12	PF08702 Fib_alpha	9.9e+02	11.3	Fibrinogen alpha/beta chain family
13	PF15908 HMMR_C	4e+02	12.6	Hyaluronan mediated motility receptor C-terminal
14	PF14662 KASH_CCD	3.3e+02	12.5	Coiled-coil region of CCDC155 or KASH
15	PF06762 LMF1	1.9e+02	12.5	Lipase maturation factor
16	PF03824 NicO	3.9e+02	11.7	High-affinity nickel-transport protein
17	PF18052 Rx_N	5.9e+02	12.1	Rx N-terminal domain
18	PF04136 Sec34	28	16.0	Sec34-like family
19	PF16331 TolA_bind_tri	4.5e+02	12.3	TolA binding protein trimerisation
20	PF07926 TPR_MLP1_2	5.7e+02	11.9	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392330

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223136	0.993	Mitochondrial fission 1 protein
2	9606.ENSP00000351273	0.990	Caspase-8
3	9606.ENSP00000247461	0.985	Calnexin
4	9606.ENSP00000302564	0.974	Bcl-2-like protein 1
5	9606.ENSP00000382508	0.943	Cell death-inducing p53-target protein 1
6	9606.ENSP00000449089	0.942	Dynamin-1-like protein
7	9606.ENSP00000393559	0.883	Phosphofurin acidic cluster sorting protein 2
8	9606.ENSP00000475168	0.868	Protein RER1
9	9606.ENSP00000303145	0.859	Transmembrane emp24 domain-containing protein 10
10	9606.ENSP00000458162	0.838	Actin, cytoplasmic 2
11	9606.ENSP00000295770	0.808	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
12	9606.ENSP00000353590	0.799	Myosin-10
13	9606.ENSP00000479488	0.788	Prohibitin
14	9606.ENSP00000316454	0.784	Phosphofurin acidic cluster sorting protein 1
15	9606.ENSP00000263735	0.779	Epithelial cell adhesion molecule
16	9606.ENSP00000218104	0.769	ATP-binding cassette sub-family D member 1
17	9606.ENSP00000262213	0.757	Translocating chain-associated membrane protein 1
18	9606.ENSP00000265333	0.749	Voltage-dependent anion-selective channel protein 1
19	9606.ENSP00000243253	0.740	Protein transport protein Sec61 subunit alpha isoform 1
20	9606.ENSP00000379873	0.730	HLA class I histocompatibility antigen, A-3 alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0048522	0.958	positive regulation of cellular process
GO:0051641	0.957	cellular localization
GO:0019222	0.956	regulation of metabolic process
GO:0045862	0.925	positive regulation of proteolysis
GO:1903050	0.922	regulation of proteolysis involved in protein catabolic process
GO:0048583	0.895	regulation of response to stimulus
GO:0009894	0.873	regulation of catabolic process
GO:1905897	0.840	regulation of response to endoplasmic reticulum stress
GO:0042176	0.832	regulation of protein catabolic process
GO:0051234	0.800	establishment of localization
GO:0031323	0.770	regulation of cellular metabolic process
GO:1903052	0.770	positive regulation of proteolysis involved in protein catabolic process
GO:0061136	0.757	regulation of proteasomal protein catabolic process
GO:0031331	0.741	positive regulation of cellular catabolic process
GO:2000058	0.714	regulation of ubiquitin-dependent protein catabolic process
GO:1905898	0.713	positive regulation of response to endoplasmic reticulum stress
GO:0006810	0.708	transport
GO:0050896	0.618	response to stimulus
GO:0033036	0.610	macromolecule localization
GO:0045732	0.574	positive regulation of protein catabolic process
GO:0008104	0.564	protein localization
GO:2000060	0.548	positive regulation of ubiquitin-dependent protein catabolic process
GO:1901800	0.547	positive regulation of proteasomal protein catabolic process
GO:0032434	0.517	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0051649	0.490	establishment of localization in cell
GO:0071840	0.464	cellular component organization or biogenesis
GO:0016043	0.425	cellular component organization
GO:0033365	0.407	protein localization to organelle
GO:0032436	0.392	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0046907	0.390	intracellular transport
GO:0008152	0.356	metabolic process
GO:0006996	0.327	organelle organization
GO:0051716	0.301	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.999	organelle membrane
GO:0005783	0.999	endoplasmic reticulum
GO:0042175	0.996	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.990	organelle subcompartment
GO:0005789	0.979	endoplasmic reticulum membrane
GO:0031982	0.970	vesicle
GO:0031410	0.877	cytoplasmic vesicle
GO:0005794	0.652	Golgi apparatus
GO:0098588	0.546	bounding membrane of organelle
GO:0071944	0.325	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]