StarFunc result for job id P51580

User Input

>input (245 residues)
MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGK
SGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKV
FKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQY
LLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLY
LLTEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51580	1.000	1.000	1.222E-55	245	1.000	1.000	P51580.pdb.gz	TPMT_HUMAN Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1
2	PDB:2bzgA	0.933	0.998	7.696E-50	229	0.935	1.000	2bzgA.pdb.gz	Structural Basis of Allele Variation of Human Thiopurine-S-Methyltransferase.
3	AFDB:O55060	0.971	0.992	8.105E-48	240	0.767	0.783	O55060.pdb.gz	TPMT_MOUSE Thiopurine S-methyltransferase OS=Mus musculus OX=10090 GN=Tpmt PE=1 SV=1
4	AFDB:Q9Z0T0	0.969	0.989	1.916E-47	240	0.767	0.783	Q9Z0T0.pdb.gz	TPMT_RAT Thiopurine S-methyltransferase OS=Rattus norvegicus OX=10116 GN=Tpmt PE=2 SV=1
5	PDB:3bgdA	0.938	0.990	2.210E-45	232	0.751	0.793	3bgdA.pdb.gz	Structural Basis of Substrate Recognition in Thiopurine S-Methyltransferase
6	AFDB:Q0WP12	0.645	0.692	6.927E-12	227	0.200	0.216	Q0WP12.pdb.gz	HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=HOL1 PE=1 SV=2
7	AFDB:Q6AWU6	0.651	0.702	1.448E-11	226	0.180	0.195	Q6AWU6.pdb.gz	HOL3_ARATH Probable thiol methyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=HOL3 PE=1 SV=1
8	AFDB:O80562	0.642	0.690	2.368E-11	227	0.180	0.194	O80562.pdb.gz	HOL2_ARATH Probable thiol methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=HOL2 PE=1 SV=1
9	PDB:3lccA	0.626	0.702	2.718E-11	216	0.204	0.231	3lccA.pdb.gz	Halomethane Biosynthesis: Structure of a SAM-Dependent Halide Methyltransferase from Arabidopsis thaliana
10	AFDB:Q93V78	0.653	0.703	3.029E-11	226	0.212	0.230	Q93V78.pdb.gz	TMT1_BRAOL Thiocyanate methyltransferase 1 OS=Brassica oleracea OX=3712 GN=TMT1 PE=1 SV=1
11	PDB:7bggA	0.561	0.628	6.458E-9	216	0.159	0.181	7bggA.pdb.gz	Structural basis of O-methylation of (2-heptyl-)1-hydroxyquinolin-4(1H)-one and related compounds by the heterocyclic toxin methyltransferase Rv0560c of Mycobacterium tuberculosis.
12	AFDB:P9WKL5	0.595	0.603	1.177E-8	241	0.167	0.170	P9WKL5.pdb.gz	HTM_MYCTU 2-heptyl-1-hydroxyquinolin-4(1H)-one methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=htm PE=1 SV=1
13	AFDB:P27680	0.530	0.428	1.251E-8	312	0.147	0.115	P27680.pdb.gz	COQ3_YEAST Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ3 PE=1 SV=2
14	AFDB:Q9SW18	0.555	0.450	1.702E-8	312	0.151	0.119	Q9SW18.pdb.gz	CHLM_ARATH Magnesium protoporphyrin IX methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLM PE=1 SV=1
15	PDB:6bqcA	0.573	0.417	7.100E-8	348	0.159	0.112	6bqcA.pdb.gz	Structural and Functional Analysis of E. coli Cyclopropane Fatty Acid Synthase.
16	PDB:5wp4A	0.536	0.287	1.313E-7	485	0.139	0.070	5wp4A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
17	PDB:4kdcA	0.539	0.600	1.396E-7	217	0.110	0.124	4kdcA.pdb.gz
18	PDB:4ineA	0.620	0.375	2.019E-7	431	0.151	0.086	4ineA.pdb.gz	Crystal structure of N-methyl transferase (PMT-2) from Caenorhabditis elegant complexed with S-adenosyl homocysteine and phosphoethanolamine
19	PDB:5wp5A	0.513	0.290	3.510E-7	463	0.143	0.076	5wp5A.pdb.gz	Conformational changes in the di-domain structure of Arabidopsis phosphoethanolamine methyltransferase leads to active-site formation.
20	PDB:2xvaA	0.581	0.698	6.490E-7	199	0.127	0.156	2xvaA.pdb.gz	Structure and Mechanism of the Chalcogen Detoxifying Protein Tehb from Escherichia Coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51580	0.0	510	245	1.000	1.000	TPMT_HUMAN Thiopurine S-methyltransferase OS=Homo sapiens OX=9606 GN=TPMT PE=1 SV=1
2	O55060	1.49e-144	405	240	0.767	0.783	TPMT_MOUSE Thiopurine S-methyltransferase OS=Mus musculus OX=10090 GN=Tpmt PE=1 SV=1
3	Q9Z0T0	5.81e-144	404	240	0.767	0.783	TPMT_RAT Thiopurine S-methyltransferase OS=Rattus norvegicus OX=10116 GN=Tpmt PE=2 SV=1
4	Q6AWU6	3.37e-04	43.1	226	0.163	0.177	HOL3_ARATH Probable thiol methyltransferase 2 OS=Arabidopsis thaliana OX=3702 GN=HOL3 PE=1 SV=1
5	Q93V78	3.49e-04	43.1	226	0.216	0.235	TMT1_BRAOL Thiocyanate methyltransferase 1 OS=Brassica oleracea OX=3712 GN=TMT1 PE=1 SV=1
6	Q0WP12	3.72e-04	42.7	227	0.216	0.233	HOL1_ARATH Thiocyanate methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=HOL1 PE=1 SV=2
7	O80562	0.024	37.4	227	0.184	0.198	HOL2_ARATH Probable thiol methyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=HOL2 PE=1 SV=1
8	X2G6C4	0.085	36.6	6267	0.086	0.003	X2G6C4_9NIDO ORF1ab polyprotein OS=Porcine coronavirus HKU15 OX=1159905 GN=orf1ab PE=1 SV=1
9	O36972	4.5	30.4	239	0.082	0.084	IKBL_ASFM2 IkB-like protein OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) OX=10500 GN=A238L PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08241 Methyltransf_11	60	15.7	Methyltransferase domain
2	PF13649 Methyltransf_25	16	17.6	Methyltransferase domain
3	PF05724 TPMT	2.5e-83	290.6	Thiopurine S-methyltransferase (TPMT)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312304

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369456	0.979	Inosine triphosphate pyrophosphatase
2	9606.ENSP00000419851	0.948	GMP synthase [glutamine-hydrolyzing]
3	9606.ENSP00000298556	0.947	Hypoxanthine-guanine phosphoribosyltransferase
4	9606.ENSP00000345096	0.944	Inosine-5'-monophosphate dehydrogenase 1
5	9606.ENSP00000368727	0.937	Xanthine dehydrogenase/oxidase
6	9606.ENSP00000321584	0.927	Inosine-5'-monophosphate dehydrogenase 2
7	9606.ENSP00000260118	0.910	Gamma-glutamyl hydrolase
8	9606.ENSP00000308895	0.908	Folate transporter 1
9	9606.ENSP00000258662	0.870	Nucleotide triphosphate diphosphatase NUDT15
10	9606.ENSP00000227155	0.804	CD82 antigen
11	9606.ENSP00000378426	0.801	Vitamin K epoxide reductase complex subunit 1
12	9606.ENSP00000304845	0.748	UDP-glucuronosyltransferase 1-1
13	9606.ENSP00000362549	0.748	UDP-glucuronosyltransferase 1-8
14	9606.ENSP00000353820	0.744	Cytochrome P450 2D6
15	9606.ENSP00000359211	0.740	Dihydropyrimidine dehydrogenase [NADP(+)]
16	9606.ENSP00000303174	0.739	UDP-glucuronosyltransferase 1-6
17	9606.ENSP00000260682	0.730	Cytochrome P450 2C9
18	9606.ENSP00000360372	0.719	Cytochrome P450 2C19
19	9606.ENSP00000256958	0.710	Solute carrier organic anion transporter family member 1B1
20	9606.ENSP00000335153	0.683	Heat shock protein HSP 90-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008119	1.000	thiopurine S-methyltransferase activity
GO:0005515	0.996	protein binding
GO:0043167	0.986	ion binding
GO:1904047	0.977	S-adenosyl-L-methionine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:1901360	0.993	organic cyclic compound metabolic process
GO:0042221	0.991	response to chemical
GO:0046483	0.990	heterocycle metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0006725	0.988	cellular aromatic compound metabolic process
GO:0044238	0.986	primary metabolic process
GO:0009056	0.966	catabolic process
GO:0006805	0.909	xenobiotic metabolic process
GO:0034641	0.856	cellular nitrogen compound metabolic process
GO:0044248	0.850	cellular catabolic process
GO:0032259	0.662	methylation
GO:0042178	0.557	xenobiotic catabolic process
GO:0006139	0.524	nucleobase-containing compound metabolic process
GO:1901564	0.415	organonitrogen compound metabolic process
GO:0044281	0.321	small molecule metabolic process
GO:1901575	0.303	organic substance catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.878	organelle
GO:0043227	0.836	membrane-bounded organelle
GO:0043231	0.816	intracellular membrane-bounded organelle
GO:0016020	0.721	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.67	1.000	thiopurine S-methyltransferase.

[back to server]