StarFunc result for job id P51587

User Input

>input (1400 residues)
MPIGSKERPTFFEIFKTRCNKADLGPISLNWFEELSSEAPPYNSEPAEESEHKNNNYEPN
LFKTPQRKPSYNQLASTPIIFKEQGLTLPLYQSPVKELDKFKLDLGRNVPNSRHKSLRTV
KTKMDQADDVSCPLLNSCLSESPVVLQCTHVTPQRDKSVVCGSLFHTPKFVKGRQTPKHI
SESLGAEVDPDMSWSSSLATPPTLSSTVLIVRNEEASETVFPHDTTANVKSYFSNHDESL
KKNDRFIASVTDSENTNQREAASHGFGKTSGNSFKVNSCKDHIGKSMPNVLEDEVYETVV
DTSEEDSFSLCFSKCRTKNLQKVRTSKTRKKIFHEANADECEKSKNQVKEKYSFVSEVEP
NDTDPLDSNVANQKPFESGSDKISKEVVPSLACEWSQLTLSGLNGAQMEKIPLLHISSCD
QNISEKDLLDTENKRKKDFLTSENSLPRISSLPKSEKPLNEETVVNKRDEEQHLESHTDC
ILAVKQAISGTSPVASSFQGIKKSIFRIRESPKETFNASFSGHMTDPNFKKETEASESGL
EIHTVCSQKEDSLCPNLIDNGSWPATTTQNSVALKNAGLISTLKKKTNKFIYAIHDETSY
KGKKIPKDQKSELINCSAQFEANAFEAPLTFANADSGLLHSSVKRSCSQNDSEEPTLSLT
SSFGTILRKCSRNETCSNNTVISQDLDYKEAKCNKEKLQLFITPEADSLSCLQEGQCEND
PKSKKVSDIKEEVLAAACHPVQHSKVEYSDTDFQSQKSLLYDHENASTLILTPTSKDVLS
NLVMISRGKESYKMSDKLKGNNYESDVELTKNIPMEKNQDVCALNENYKNVELLPPEKYM
RVASPSRKVQFNQNTNLRVIQKNQEETTSISKITVNPDSEELFSDNENNFVFQVANERNN
LALGNTKELHETDLTCVNEPIFKNSTMVLYGDTGDKQATQVSIKKDLVYVLAEENKNSVK
QHIKMTLGQDLKSDISLNIDKIPEKNNDYMNKWAGLLGPISNHSFGGSFRTASNKEIKLS
EHNIKKSKMFFKDIEEQYPTSLACVEIVNTLALDNQKKLSKPQSINTVSAHLQSSVVVSD
CKNSHITPQMLFSKQDFNSNHNLTPSQKAEITELSTILEESGSQFEFTQFRKPSYILQKS
TFEVPENQMTILKTTSEECRDADLHVIMNAPSIGQVDSSKQFEGTVEIKRKFAGLLKNDC
NKSASGYLTDENEVGFRGFYSAHGTKLNVSTEALQKAVKLFSDIENISEETSAEVHPISL
SSSKCHDSVVSMFKIENHNDKTVSEKNNKCQLILQNNIEMTTGTFVEEITENYKRNTENE
DNKYTAASRNSHNLEFDGSDSSKNDTVCIHKDETDLLFTDQHNICLKLSGQFMKEGNTQI
KEDLSDLTFLEVAKAQEACH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8IRB5	0.035	0.035	8.767E-5	1465	0.137	0.131	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
2	AFDB:Q7K480	0.033	0.033	1.690E-3	1367	0.117	0.120	Q7K480.pdb.gz	MEPCE_DROME 7SK snRNA methylphosphate capping enzyme bin3 OS=Drosophila melanogaster OX=7227 GN=bin3 PE=1 SV=1
3	AFDB:Q4QY64	0.044	0.037	1.803E-3	1826	0.115	0.088	Q4QY64.pdb.gz	ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus OX=10090 GN=Atad5 PE=1 SV=1
4	AFDB:A2BIH4	0.038	0.044	2.652E-3	1169	0.106	0.127	A2BIH4.pdb.gz	A2BIH4_DANRE Zinc finger protein 644a OS=Danio rerio OX=7955 GN=fi40c02 PE=4 SV=1
5	AFDB:Q8ILT4	0.030	0.024	3.216E-3	2280	0.153	0.094	Q8ILT4.pdb.gz	MCA3_PLAF7 Metacaspase-3 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=MCA3 PE=1 SV=1
6	AFDB:Q8I398	0.040	0.032	4.731E-3	2112	0.116	0.077	Q8I398.pdb.gz	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
7	AFDB:A0A5F8MPU3	0.037	0.026	5.380E-3	2282	0.176	0.108	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
8	AFDB:Q9NZM4	0.038	0.035	6.525E-3	1560	0.124	0.111	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
9	AFDB:B1AYB6	0.037	0.037	9.001E-3	1498	0.124	0.116	B1AYB6.pdb.gz	MBD5_MOUSE Methyl-CpG-binding domain protein 5 OS=Mus musculus OX=10090 GN=Mbd5 PE=2 SV=1
10	AFDB:P11978	0.039	0.039	1.024E-2	1358	0.125	0.129	P11978.pdb.gz	SIR4_YEAST Regulatory protein SIR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIR4 PE=1 SV=1
11	PDB:5c8dE	0.021	0.085	5.878	280	0.005	0.025	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
12	PDB:7stmA	0.024	0.037	6.684	801	0.006	0.011	7stmA.pdb.gz	Structural basis for inhibition and regulation of a chitin synthase from Candida albicans.
13	PDB:6n8jb	0.023	0.043	7.602	647	0.017	0.037	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
14	PDB:7wttK	0.015	0.020	7.602	1022	0.010	0.014	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35923	0.0	1328	3343	0.544	0.228	BRCA2_RAT Breast cancer type 2 susceptibility protein homolog OS=Rattus norvegicus OX=10116 GN=Brca2 PE=1 SV=1
2	P51587	0.0	2880	3418	1.000	0.410	BRCA2_HUMAN Breast cancer type 2 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA2 PE=1 SV=4
3	P97929	0.0	1334	3329	0.567	0.239	BRCA2_MOUSE Breast cancer type 2 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca2 PE=1 SV=2
4	Q8R4X4	0.0	664	1485	0.269	0.254	Q8R4X4_CRIGR BRCA2 (Fragment) OS=Cricetulus griseus OX=10029 GN=BRCA2 PE=1 SV=1
5	Q8QFV6	1.75e-46	186	3398	0.086	0.035	Q8QFV6_CHICK Breast cancer susceptibility protein OS=Gallus gallus OX=9031 GN=BRCA2 PE=2 SV=1
6	Q2HR92	2.1	35.0	669	0.019	0.040	HEPA_HHV8P DNA helicase/primase complex-associated protein OS=Human herpesvirus 8 type P (isolate GK18) OX=868565 GN=ORF40 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00634 BRCA2	1.2e-16	71.1	BRCA2 repeat
2	PF18028 Zmiz1_N	3e+02	13.1	Zmiz1 N-terminal tetratricopeptide repeat domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369497

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261584	0.999	Partner and localizer of BRCA2
2	9606.ENSP00000287647	0.999	Fanconi anemia group D2 protein
3	9606.ENSP00000372088	0.999	DNA repair protein RAD51 homolog 1
4	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
5	9606.ENSP00000260947	0.998	BRCA1-associated RING domain protein 1
6	9606.ENSP00000367910	0.998	Fanconi anemia group G protein
7	9606.ENSP00000451974	0.998	DNA repair protein XRCC3
8	9606.ENSP00000481021	0.998	Putative protein SEM1, isoform 2
9	9606.ENSP00000278616	0.996	Serine-protein kinase ATM
10	9606.ENSP00000310842	0.996	Fanconi anemia group I protein
11	9606.ENSP00000328269	0.996	High mobility group 20B
12	9606.ENSP00000336701	0.996	DNA repair protein RAD51 homolog 3
13	9606.ENSP00000263754	0.995	Histone acetyltransferase KAT2B
14	9606.ENSP00000357748	0.994	BRCA2 and CDKN1A-interacting protein
15	9606.ENSP00000433205	0.993	BRCA2-interacting transcriptional repressor EMSY
16	9606.ENSP00000269305	0.989	Cellular tumor antigen p53
17	9606.ENSP00000388648	0.987	Serine/threonine-protein kinase Chk1
18	9606.ENSP00000313851	0.985	Sister chromatid cohesion protein PDS5 homolog B
19	9606.ENSP00000343741	0.982	Serine/threonine-protein kinase ATR
20	9606.ENSP00000294008	0.981	Structure-specific endonuclease subunit SLX4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.810	organic cyclic compound binding
GO:1901363	0.805	heterocyclic compound binding
GO:0003676	0.715	nucleic acid binding
GO:0003677	0.667	DNA binding
GO:0003697	0.448	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006302	0.987	double-strand break repair
GO:0019222	0.957	regulation of metabolic process
GO:0071840	0.914	cellular component organization or biogenesis
GO:0016043	0.871	cellular component organization
GO:0022402	0.863	cell cycle process
GO:0051179	0.843	localization
GO:0006996	0.827	organelle organization
GO:0050794	0.682	regulation of cellular process
GO:0060255	0.639	regulation of macromolecule metabolic process
GO:0048518	0.595	positive regulation of biological process
GO:0051171	0.412	regulation of nitrogen compound metabolic process
GO:0080090	0.408	regulation of primary metabolic process
GO:0031323	0.403	regulation of cellular metabolic process
GO:0048522	0.396	positive regulation of cellular process
GO:0006310	0.382	DNA recombination
GO:0019219	0.379	regulation of nucleobase-containing compound metabolic process
GO:0051641	0.376	cellular localization
GO:0048523	0.374	negative regulation of cellular process
GO:0009628	0.371	response to abiotic stimulus
GO:0034502	0.362	protein localization to chromosome
GO:0000724	0.355	double-strand break repair via homologous recombination
GO:0051234	0.348	establishment of localization
GO:0010212	0.328	response to ionizing radiation
GO:0000278	0.307	mitotic cell cycle
GO:0045184	0.303	establishment of protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005694	0.995	chromosome
GO:0005737	0.993	cytoplasm
GO:0032991	0.992	protein-containing complex
GO:1902494	0.793	catalytic complex
GO:1990234	0.762	transferase complex
GO:0005829	0.736	cytosol
GO:0000228	0.731	nuclear chromosome
GO:0005856	0.662	cytoskeleton
GO:0012505	0.640	endomembrane system
GO:0015630	0.621	microtubule cytoskeleton
GO:0140513	0.587	nuclear protein-containing complex
GO:0140535	0.579	intracellular protein-containing complex
GO:1990391	0.566	DNA repair complex
GO:0000793	0.558	condensed chromosome
GO:0098687	0.541	chromosomal region
GO:0000794	0.508	condensed nuclear chromosome
GO:0000152	0.492	nuclear ubiquitin ligase complex
GO:0000800	0.475	lateral element
GO:0031982	0.469	vesicle
GO:0005815	0.461	microtubule organizing center
GO:0000781	0.453	chromosome, telomeric region
GO:0005813	0.383	centrosome
GO:0031410	0.337	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]