StarFunc result for job id P51608

User Input

>input (486 residues)
MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSAEPAEAG
KAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKY
DVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQKPPKKPKSPK
APGTGRGRGRPKGSGTTRPKAATSEGVQVKRVLEKSPGKLLVKMPFQTSPGGKAEGGGAT
TSTQVMVIKRPGRKRKAEADPQAIPKKRGRKPGSVVAAAAAEAKKKAVKESSIRSVQETV
LPIKKRKTRETVSIEVKEVVKPLLVSTLGEKSGKGLKTCKSPGRKSKESSPKGRSSSASS
PPKKEHHHHHHHSESPKAPVPLLPPLPPPPPEPESSEDPTSPPEPQDLSSSVCKEEKMPR
GGSLESDGCPKEPAKTQPAVATAATAAEKYKHRGEGERKDIVSSSMPRPNREEPVDSRTP
VTERVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VKC4	0.259	0.253	1.762E-61	498	0.984	0.960	A0A140VKC4.pdb.gz	A0A140VKC4_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2 PE=2 SV=1
2	AFDB:Q7T2T7	0.282	0.265	2.064E-30	524	0.535	0.496	Q7T2T7.pdb.gz	Q7T2T7_DANRE Methyl-CpG-binding protein 2 OS=Danio rerio OX=7955 GN=wu:fk96a04 PE=2 SV=2
3	PDB:7ao8C	0.111	0.728	6.060E-6	64	0.060	0.453	7ao8C.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
4	AFDB:Q63767	0.073	0.044	1.915E-2	968	0.156	0.079	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
5	AFDB:Q9Y6F6	0.063	0.037	1.741E-1	904	0.167	0.090	Q9Y6F6.pdb.gz	IRAG1_HUMAN Inositol 1,4,5-triphosphate receptor associated 1 OS=Homo sapiens OX=9606 GN=IRAG1 PE=1 SV=4
6	PDB:2mgsA	0.058	0.274	1.965E-1	71	0.016	0.113	2mgsA.pdb.gz
7	AFDB:Q75N03	0.073	0.072	2.116E-1	491	0.123	0.122	Q75N03.pdb.gz	HAKAI_HUMAN E3 ubiquitin-protein ligase Hakai OS=Homo sapiens OX=9606 GN=CBLL1 PE=1 SV=1
8	AFDB:F1NSM7	0.072	0.053	3.123E-1	743	0.156	0.102	F1NSM7.pdb.gz	OC116_CHICK Ovocleidin-116 OS=Gallus gallus OX=9031 PE=1 SV=1
9	AFDB:Q7TPK6	0.069	0.034	3.123E-1	1222	0.187	0.074	Q7TPK6.pdb.gz	WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus OX=10116 GN=Wnk4 PE=1 SV=3
10	AFDB:Q96J92	0.088	0.039	3.333E-1	1243	0.177	0.069	Q96J92.pdb.gz	WNK4_HUMAN Serine/threonine-protein kinase WNK4 OS=Homo sapiens OX=9606 GN=WNK4 PE=1 SV=1
11	AFDB:A8HAM3	0.067	0.062	4.321E-1	539	0.158	0.143	A8HAM3.pdb.gz	A8HAM3_DANRE Serum response factor a OS=Danio rerio OX=7955 GN=srf PE=4 SV=1
12	PDB:1f9rA	0.057	0.244	4.570E-1	65	0.010	0.077	1f9rA.pdb.gz
13	PDB:2wtzC	0.067	0.073	4.876E-1	439	0.027	0.030	2wtzC.pdb.gz	ATP-Dependent Mure Ligase in Mycobacterium Tuberculosis: Biochemical and Structural Characterisation.
14	AFDB:Q9VNL6	0.062	0.045	4.920E-1	730	0.150	0.100	Q9VNL6.pdb.gz	Q9VNL6_DROME MIP10102p OS=Drosophila melanogaster OX=7227 GN=anon-f PE=2 SV=1
15	PDB:5wyjCB	0.061	0.028	5.203E-1	1098	0.016	0.007	5wyjCB.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
16	PDB:7lbmr	0.066	0.035	5.552E-1	1034	0.016	0.008	7lbmr.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
17	PDB:1qe6D	0.053	0.195	6.746E-1	72	0.012	0.083	1qe6D.pdb.gz
18	PDB:2fs2B	0.042	0.121	7.199E-1	138	0.016	0.058	2fs2B.pdb.gz
19	PDB:2wtzB	0.067	0.065	7.199E-1	508	0.027	0.026	2wtzB.pdb.gz	ATP-Dependent Mure Ligase in Mycobacterium Tuberculosis: Biochemical and Structural Characterisation.
20	PDB:4juuA	0.060	0.090	7.682E-1	315	0.014	0.022	4juuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VKC4	0.0	934	498	0.981	0.958	A0A140VKC4_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2 PE=2 SV=1
2	D3YJ43	0.0	953	486	1.000	1.000	D3YJ43_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2 PE=2 SV=1
3	P51608	0.0	953	486	1.000	1.000	MECP2_HUMAN Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2 PE=1 SV=1
4	Q00566	0.0	705	492	0.949	0.937	MECP2_RAT Methyl-CpG-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Mecp2 PE=1 SV=1
5	Q9Z2D6	0.0	717	484	0.951	0.955	MECP2_MOUSE Methyl-CpG-binding protein 2 OS=Mus musculus OX=10090 GN=Mecp2 PE=1 SV=1
6	Q7T2T7	5.25e-97	304	524	0.477	0.443	Q7T2T7_DANRE Methyl-CpG-binding protein 2 OS=Danio rerio OX=7955 GN=wu:fk96a04 PE=2 SV=2
7	A8WIP2	5.45e-97	304	523	0.477	0.444	A8WIP2_DANRE Methyl-CpG-binding protein 2 OS=Danio rerio OX=7955 GN=wu:fk96a04 PE=4 SV=1
8	A0A8I5ZTJ7	6.63e-16	82.4	532	0.074	0.068	A0A8I5ZTJ7_RAT Methyl-CpG-binding domain protein 4 OS=Rattus norvegicus OX=10116 GN=Mbd4 PE=4 SV=1
9	O95243	6.68e-16	82.8	580	0.080	0.067	MBD4_HUMAN Methyl-CpG-binding domain protein 4 OS=Homo sapiens OX=9606 GN=MBD4 PE=1 SV=1
10	D4A9W8	8.25e-16	82.4	549	0.084	0.075	D4A9W8_RAT Methyl-CpG-binding domain protein 4 OS=Rattus norvegicus OX=10116 GN=Mbd4 PE=4 SV=4
11	A0A8I6AH85	1.55e-15	81.6	590	0.074	0.061	A0A8I6AH85_RAT Methyl-CpG binding domain 4 DNA glycosylase OS=Rattus norvegicus OX=10116 GN=Mbd4 PE=4 SV=1
12	Q9Z2D7	2.58e-15	80.9	554	0.076	0.067	MBD4_MOUSE Methyl-CpG-binding domain protein 4 OS=Mus musculus OX=10090 GN=Mbd4 PE=1 SV=1
13	X6RBL6	1.18e-10	63.9	241	0.086	0.174	X6RBL6_HUMAN Methyl-CpG binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
14	Q9UBB5	4.30e-10	63.9	411	0.086	0.102	MBD2_HUMAN Methyl-CpG-binding domain protein 2 OS=Homo sapiens OX=9606 GN=MBD2 PE=1 SV=1
15	A0A8I6AFM4	9.44e-10	61.2	246	0.080	0.159	A0A8I6AFM4_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=1
16	B0BNM2	2.83e-09	61.2	412	0.080	0.095	B0BNM2_RAT Mbd2 protein OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=2 SV=1
17	D4A986	2.83e-09	61.2	412	0.080	0.095	D4A986_RAT Methyl-CpG binding domain protein 2 OS=Rattus norvegicus OX=10116 GN=Mbd2 PE=1 SV=3
18	Q9Z2E1	2.87e-09	61.2	414	0.080	0.094	MBD2_MOUSE Methyl-CpG-binding domain protein 2 OS=Mus musculus OX=10090 GN=Mbd2 PE=1 SV=2
19	O95983	2.66e-07	54.3	291	0.058	0.096	MBD3_HUMAN Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3 PE=1 SV=1
20	Q9Z2D8	3.36e-07	54.3	285	0.058	0.098	MBD3_MOUSE Methyl-CpG-binding domain protein 3 OS=Mus musculus OX=10090 GN=Mbd3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01429 MBD	1.5e-13	61.5	Methyl-CpG binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000001412

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000009527	0.989	SIN3 transcription regulator family member A
2	9555.ENSPANP00000004176	0.984	Histone deacetylase 1
3	9555.ENSPANP00000015145	0.960	Histone deacetylase 2
4	9555.ENSPANP00000002656	0.942	cAMP responsive element binding protein 1
5	9555.ENSPANP00000017795	0.941	Transducin (beta)-like 1 X-linked receptor 1
6	9555.ENSPANP00000010373	0.927	SIN3 transcription regulator family member B
7	9555.ENSPANP00000005258	0.920	Transducin (beta)-like 1X-linked
8	9555.ENSPANP00000008285	0.918	ATRX, chromatin remodeler
9	9555.ENSPANP00000003628	0.890	Lamin B receptor
10	9555.ENSPANP00000019731	0.859	Nuclear receptor corepressor 1
11	9555.ENSPANP00000003625	0.856	During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS
12	9555.ENSPANP00000013256	0.854	REST corepressor 1
13	9555.ENSPANP00000000133	0.833	DNA (cytosine-5-)-methyltransferase 1
14	9555.ENSPANP00000000238	0.815	Uncharacterized protein
15	9555.ENSPANP00000011773	0.814	Nuclear receptor corepressor 2
16	9555.ENSPANP00000015194	0.814	DGCR8 microprocessor complex subunit
17	9555.ENSPANP00000000044	0.808	RB binding protein 7, chromatin remodeling factor
18	9555.ENSPANP00000018792	0.808	Retinoblastoma binding protein 4
19	9555.ENSPANP00000001672	0.797	Histone deacetylase 3
20	9555.ENSPANP00000008768	0.788	REST corepressor 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140110	0.999	transcription regulator activity
GO:0003682	0.999	chromatin binding
GO:0010385	0.999	double-stranded methylated DNA binding
GO:0005515	0.998	protein binding
GO:0043565	0.998	sequence-specific DNA binding
GO:0000166	0.998	nucleotide binding
GO:0008327	0.993	methyl-CpG binding
GO:0003700	0.944	DNA-binding transcription factor activity
GO:0019904	0.864	protein domain specific binding
GO:0003712	0.807	transcription coregulator activity
GO:0003714	0.763	transcription corepressor activity
GO:1990841	0.723	promoter-specific chromatin binding
GO:0000217	0.720	DNA secondary structure binding
GO:0060090	0.573	molecular adaptor activity
GO:0003723	0.520	RNA binding
GO:0098772	0.394	molecular function regulator activity
GO:1990837	0.365	sequence-specific double-stranded DNA binding
GO:0003824	0.357	catalytic activity
GO:0030674	0.302	protein-macromolecule adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.998	regulation of primary metabolic process
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0031323	0.997	regulation of cellular metabolic process
GO:0048518	0.995	positive regulation of biological process
GO:0048522	0.992	positive regulation of cellular process
GO:0000122	0.991	negative regulation of transcription by RNA polymerase II
GO:0050896	0.990	response to stimulus
GO:2000026	0.989	regulation of multicellular organismal development
GO:0071840	0.988	cellular component organization or biogenesis
GO:0032501	0.982	multicellular organismal process
GO:0051128	0.980	regulation of cellular component organization
GO:0051716	0.979	cellular response to stimulus
GO:0016043	0.979	cellular component organization
GO:0032502	0.978	developmental process
GO:0010604	0.972	positive regulation of macromolecule metabolic process
GO:0045595	0.958	regulation of cell differentiation
GO:0051173	0.956	positive regulation of nitrogen compound metabolic process
GO:0031325	0.956	positive regulation of cellular metabolic process
GO:0048856	0.951	anatomical structure development
GO:0045935	0.950	positive regulation of nucleobase-containing compound metabolic process
GO:0007275	0.942	multicellular organism development
GO:0010629	0.928	negative regulation of gene expression
GO:0071704	0.924	organic substance metabolic process
GO:0044238	0.910	primary metabolic process
GO:0048513	0.905	animal organ development
GO:0006807	0.893	nitrogen compound metabolic process
GO:0006325	0.893	chromatin organization
GO:0030154	0.880	cell differentiation
GO:0065008	0.873	regulation of biological quality
GO:0043170	0.873	macromolecule metabolic process
GO:0048731	0.870	system development
GO:0051052	0.860	regulation of DNA metabolic process
GO:0040012	0.842	regulation of locomotion
GO:0051093	0.837	negative regulation of developmental process
GO:0044237	0.834	cellular metabolic process
GO:0007399	0.822	nervous system development
GO:0032886	0.821	regulation of microtubule-based process
GO:0065009	0.817	regulation of molecular function
GO:0042127	0.744	regulation of cell population proliferation
GO:0051960	0.741	regulation of nervous system development
GO:0031328	0.737	positive regulation of cellular biosynthetic process
GO:0051241	0.715	negative regulation of multicellular organismal process
GO:0022008	0.705	neurogenesis
GO:0060322	0.702	head development
GO:0023051	0.700	regulation of signaling
GO:0010646	0.700	regulation of cell communication
GO:0006950	0.698	response to stress
GO:0051726	0.696	regulation of cell cycle
GO:0007417	0.692	central nervous system development
GO:0010557	0.688	positive regulation of macromolecule biosynthetic process
GO:0050767	0.680	regulation of neurogenesis
GO:0051254	0.671	positive regulation of RNA metabolic process
GO:1903508	0.662	positive regulation of nucleic acid-templated transcription
GO:0044030	0.649	regulation of DNA methylation
GO:0003008	0.616	system process
GO:0007610	0.596	behavior
GO:0006996	0.565	organelle organization
GO:0007420	0.561	brain development
GO:0010632	0.527	regulation of epithelial cell migration
GO:0014013	0.527	regulation of gliogenesis
GO:0033043	0.505	regulation of organelle organization
GO:0042221	0.492	response to chemical
GO:1901564	0.491	organonitrogen compound metabolic process
GO:0044260	0.489	cellular macromolecule metabolic process
GO:0022603	0.487	regulation of anatomical structure morphogenesis
GO:0045893	0.485	positive regulation of DNA-templated transcription
GO:0007154	0.466	cell communication
GO:0043412	0.466	macromolecule modification
GO:0023052	0.465	signaling
GO:0007165	0.464	signal transduction
GO:0019538	0.455	protein metabolic process
GO:0006952	0.445	defense response
GO:0051246	0.445	regulation of protein metabolic process
GO:0048583	0.443	regulation of response to stimulus
GO:0051094	0.440	positive regulation of developmental process
GO:0010594	0.438	regulation of endothelial cell migration
GO:0008284	0.425	positive regulation of cell population proliferation
GO:0010033	0.424	response to organic substance
GO:0036211	0.417	protein modification process
GO:0034330	0.411	cell junction organization
GO:0040013	0.408	negative regulation of locomotion
GO:0070887	0.402	cellular response to chemical stimulus
GO:0010628	0.399	positive regulation of gene expression
GO:0045596	0.398	negative regulation of cell differentiation
GO:0040029	0.387	epigenetic regulation of gene expression
GO:0009628	0.351	response to abiotic stimulus
GO:0048699	0.336	generation of neurons
GO:0051240	0.330	positive regulation of multicellular organismal process
GO:1901360	0.315	organic cyclic compound metabolic process
GO:0045944	0.306	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.974	intracellular non-membrane-bounded organelle
GO:0005694	0.698	chromosome
GO:0000785	0.473	chromatin
GO:0005737	0.464	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]