StarFunc result for job id P51610

User Input

>input (2035 residues)
MASAVSPANLPAVLLQPRWKRVVGWSGPVPRPRHGHRAVAIKELIVVFGGGNEGIVDELH
VYNTATNQWFIPAVRGDIPPGCAAYGFVCDGTRLLVFGGMVEYGKYSNDLYELQASRWEW
KRLKAKTPKNGPPPCPRLGHSFSLVGNKCYLFGGLANDSEDPKNNIPRYLNDLYILELRP
GSGVVAWDIPITYGVLPPPRESHTAVVYTEKDNKKSKLVIYGGMSGCRLGDLWTLDIDTL
TWNKPSLSGVAPLPRSLHSATTIGNKMYVFGGWVPLVMDDVKVATHEKEWKCTNTLACLN
LDTMAWETILMDTLEDNIPRARAGHCAVAINTRLYIWSGRDGYRKAWNNQVCCKDLWYLE
TEKPPPPARVQLVRANTNSLEVSWGAVATADSYLLQLQKYDIPATAATATSPTPNPVPSV
PANPPKSPAPAAAAPAVQPLTQVGITLLPQAAPAPPTTTTIQVLPTVPGSSISVPTAART
QGVPAVLKVTGPQATTGTPLVTMRPASQAGKAPVTVTSLPAGVRMVVPTQSAQGTVIGSS
PQMSGMAALAAAAAATQKIPPSSAPTVLSVPAGTTIVKTMAVTPGTTTLPATVKVASSPV
MVSNPATRMLKTAAAQVGTSVSSATNTSTRPIITVHKSGTVTVAQQAQVVTTVVGGVTKT
ITLVKSPISVPGGSALISNLGKVMSVVQTKPVQTSAVTGQASTGPVTQIIQTKGPLPAGT
ILKLVTSADGKPTTIITTTQASGAGTKPTILGISSVSPSTTKPGTTTIIKTIPMSAIITQ
AGATGVTSSPGIKSPITIITTKVMTSGTGAPAKIITAVPKIATGHGQQGVTQVVLKGAPG
QPGTILRTVPMGGVRLVTPVTVSAVKPAVTTLVVKGTTGVTTLGTVTGTVSTSLAGAGGH
STSASLATPITTLGTIATLSSQVINPTAITVSAAQTTLTAAGGLTTPTITMQPVSQPTQV
TLITAPSGVEAQPVHDLPVSILASPTTEQPTATVTIADSGQGDVQPGTVTLVCSNPPCET
HETGTTNTATTTVVANLGGHPQPTQVQFVCDRQEAAASLVTSTVGQQNGSVVRVCSNPPC
ETHETGTTNTATTATSNMAGQHGCSNPPCETHETGTTNTATTAMSSVGANHQRDARRACA
AGTPAVIRISVATGALEAAQGSKSQCQTRQTSATSTTMTVMATGAPCSAGPLLGPSMARE
PGGRSPAFVQLAPLSSKVRLSSPSIKDLPAGRHSHAVSTAAMTRSSVGAGEPRMAPVCES
LQGGSPSTTVTVTALEALLCPSATVTQVCSNPPCETHETGTTNTATTSNAGSAQRVCSNP
PCETHETGTTHTATTATSNGGTGQPEGGQQPPAGRPCETHQTTSTGTTMSVSVGALLPDA
TSSHRTVESGLEVAAAPSVTPQAGTALLAPFPTQRVCSNPPCETHETGTTHTATTVTSNM
SSNQDPPPAASDQGEVESTQGDSVNITSSSAITTTVSSTLTRAVTTVTQSTPVPGPSVPP
PEELQVSPGPRQQLPPRQLLQSASTALMGESAEVLSASQTPELPAAVDLSSTGEPSSGQE
SAGSAVVATVVVQPPPPTQSEVDQLSLPQELMAEAQAGTTTLMVTGLTPEELAVTAAAEA
AAQAAATEEAQALAIQAVLQAAQQAVMGTGEPMDTSEAAATVTQAELGHLSAEGQEGQAT
TIPIVLTQQELAALVQQQQLQEAQAQQQHHHLPTEALAPADSLNDPAIESNCLNELAGTV
PSTVALLPSTATESLAPSNTFVAPQPVVVASPAKLQAAATLTEVANGIESLGVKPDLPPP
PSKAPMKKENQWFDVGVIKGTNVMVTHYFLPPDDAVPSDDDLGTVPDYNQLKKQELQPGT
AYKFRVAGINACGRGPFSEISAFKTCLPGFPGAPCAIKISKSPDGAHLTWEPPSVTSGKI
IEYSVYLAIQSSQAGGELKSSTPAQLAFMRVYCGPSPSCLVQSSSLSNAHIDYTTKPAII
FRIAARNEKGYGPATQVRWLQETSKDSSGTKPANKRPMSSPEMKSAPKKSKADGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8WIP5	0.346	0.352	0.000	1993	0.664	0.678	A8WIP5.pdb.gz
2	AFDB:P51611	0.371	0.362	0.000	2090	0.939	0.914	P51611.pdb.gz	HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus OX=10036 GN=HCFC1 PE=1 SV=1
3	AFDB:Q61191	0.340	0.338	0.000	2045	0.943	0.938	Q61191.pdb.gz	HCFC1_MOUSE Host cell factor 1 OS=Mus musculus OX=10090 GN=Hcfc1 PE=1 SV=2
4	AFDB:Q9V4C8	0.289	0.388	8.678E-85	1500	0.282	0.382	Q9V4C8.pdb.gz	HCF_DROME Host cell factor OS=Drosophila melanogaster OX=7227 GN=Hcf PE=1 SV=2
5	AFDB:Q9Y5Z7	0.279	0.692	3.428E-65	792	0.219	0.562	Q9Y5Z7.pdb.gz	HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens OX=9606 GN=HCFC2 PE=1 SV=1
6	AFDB:Q5RKG2	0.280	0.757	1.869E-63	723	0.201	0.566	Q5RKG2.pdb.gz	HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus OX=10116 GN=Hcfc2 PE=2 SV=1
7	PDB:5gqtA	0.140	0.575	4.502E-20	470	0.041	0.177	5gqtA.pdb.gz
8	PDB:5gq0A	0.143	0.797	1.625E-19	338	0.039	0.234	5gq0A.pdb.gz
9	PDB:2uvkB	0.127	0.649	1.201E-11	349	0.028	0.163	2uvkB.pdb.gz
10	PDB:2zwaB	0.133	0.369	4.554E-11	683	0.029	0.085	2zwaB.pdb.gz	Structural basis of tRNA modification with CO2 fixation and methylation by wybutosine synthesizing enzyme TYW4.
11	PDB:6dbjD	0.130	0.607	1.373E-9	352	0.029	0.168	6dbjD.pdb.gz	DNA melting initiates the RAG catalytic pathway.
12	PDB:6oemB	0.126	0.611	1.443E-9	346	0.027	0.156	6oemB.pdb.gz	Cutting antiparallel DNA strands in a single active site.
13	PDB:5jowA	0.101	0.320	1.599E-6	504	0.025	0.101	5jowA.pdb.gz
14	PDB:7rroe	0.100	0.277	9.934E-6	610	0.025	0.082	7rroe.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
15	PDB:6pxvA	0.054	0.120	1.152E-5	823	0.017	0.041	6pxvA.pdb.gz
16	PDB:8dtlA	0.052	0.123	1.474E-5	741	0.020	0.054	8dtlA.pdb.gz
17	AFDB:Q09847	0.092	0.129	1.011E-3	1325	0.070	0.107	Q09847.pdb.gz	NU146_SCHPO Nucleoporin nup146 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nup146 PE=1 SV=1
18	AFDB:Q80U93	0.103	0.101	1.116E-3	2085	0.142	0.138	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2
19	AFDB:Q9NRJ4	0.098	0.123	1.360E-3	1543	0.105	0.139	Q9NRJ4.pdb.gz	TULP4_HUMAN Tubby-related protein 4 OS=Homo sapiens OX=9606 GN=TULP4 PE=1 SV=2
20	AFDB:P40477	0.092	0.120	1.657E-3	1460	0.082	0.114	P40477.pdb.gz	NU159_YEAST Nucleoporin NUP159 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP159 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NEM2	0.0	4035	2080	1.000	0.978	A6NEM2_HUMAN Host cell factor C1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2
2	D3ZN95	0.0	3278	2034	0.932	0.933	HCFC1_RAT Host cell factor 1 OS=Rattus norvegicus OX=10116 GN=Hcfc1 PE=1 SV=1
3	P51610	0.0	4058	2035	1.000	1.000	HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens OX=9606 GN=HCFC1 PE=1 SV=2
4	P51611	0.0	3261	2090	0.932	0.908	HCFC1_MESAU Host cell factor 1 OS=Mesocricetus auratus OX=10036 GN=HCFC1 PE=1 SV=1
5	Q5RKG2	0.0	581	723	0.125	0.353	HCFC2_RAT Host cell factor 2 OS=Rattus norvegicus OX=10116 GN=Hcfc2 PE=2 SV=1
6	Q61191	0.0	3257	2045	0.938	0.933	HCFC1_MOUSE Host cell factor 1 OS=Mus musculus OX=10090 GN=Hcfc1 PE=1 SV=2
7	Q9V4C8	0.0	631	1500	0.130	0.177	HCF_DROME Host cell factor OS=Drosophila melanogaster OX=7227 GN=Hcf PE=1 SV=2
8	Q9Y5Z7	0.0	597	792	0.129	0.331	HCFC2_HUMAN Host cell factor 2 OS=Homo sapiens OX=9606 GN=HCFC2 PE=1 SV=1
9	G5EC23	7.14e-140	458	782	0.114	0.295	HCF1_CAEEL Host cell factor homolog hcf-1 OS=Caenorhabditis elegans OX=6239 GN=hcf-1 PE=1 SV=1
10	Q9BQ90	2.58e-26	115	382	0.041	0.220	KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens OX=9606 GN=KLHDC3 PE=1 SV=1
11	Q8VEM9	9.85e-26	114	382	0.042	0.223	KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus OX=10090 GN=Klhdc3 PE=2 SV=1
12	Q9MA55	1.32e-25	117	668	0.048	0.147	ACBP4_ARATH Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1
13	Q10AZ7	1.67e-23	109	501	0.057	0.234	GPA3_ORYSJ Protein GLUTELIN PRECURSOR ACCUMULATION 3 OS=Oryza sativa subsp. japonica OX=39947 GN=GPA3 PE=1 SV=1
14	Q8RWD9	4.62e-23	108	648	0.048	0.150	ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=ACBP5 PE=1 SV=1
15	P87061	7.92e-22	106	1147	0.039	0.069	TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tea1 PE=1 SV=1
16	Q4G5Y1	7.47e-20	96.7	406	0.039	0.197	KLDC2_MOUSE Kelch domain-containing protein 2 OS=Mus musculus OX=10090 GN=Klhdc2 PE=2 SV=3
17	Q54CD2	1.87e-19	97.8	716	0.037	0.106	Q54CD2_DICDI Kelch repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293044 PE=4 SV=1
18	G3V3U8	2.95e-19	94.0	357	0.038	0.216	G3V3U8_HUMAN Kelch domain containing 2 OS=Homo sapiens OX=9606 GN=KLHDC2 PE=1 SV=1
19	G5EAY1	3.35e-19	97.8	1474	0.048	0.066	G5EAY1_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=teaA PE=4 SV=1
20	G3V2H2	4.71e-19	92.4	307	0.038	0.251	G3V2H2_HUMAN Kelch domain containing 2 OS=Homo sapiens OX=9606 GN=KLHDC2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	2.7e-06	39.0	Fibronectin type III domain
2	PF01344 Kelch_1	2.1e-21	86.5	Kelch motif
3	PF07646 Kelch_2	4.8e-12	56.6	Kelch motif
4	PF13415 Kelch_3	3.2e-25	99.2	Galactose oxidase, central domain
5	PF13418 Kelch_4	8.2e-21	85.0	Galactose oxidase, central domain
6	PF13854 Kelch_5	5.4e-27	104.5	Kelch motif
7	PF13964 Kelch_6	6.5e-20	81.9	Kelch motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309555

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262519	0.999	Histone-lysine N-methyltransferase SETD1A
2	9606.ENSP00000351446	0.999	WD repeat-containing protein 5
3	9606.ENSP00000362824	0.999	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
4	9606.ENSP00000417132	0.999	Ubiquitin carboxyl-terminal hydrolase BAP1
5	9606.ENSP00000262238	0.995	Transcriptional repressor protein YY1
6	9606.ENSP00000340896	0.995	Set1/Ash2 histone methyltransferase complex subunit ASH2
7	9606.ENSP00000264515	0.994	Retinoblastoma-binding protein 5
8	9606.ENSP00000342136	0.994	Cyclic AMP-responsive element-binding protein 3
9	9606.ENSP00000296490	0.991	WD repeat-containing protein 82
10	9606.ENSP00000345837	0.988	Protein dpy-30 homolog
11	9606.ENSP00000436786	0.988	Histone-lysine N-methyltransferase 2A
12	9606.ENSP00000356840	0.979	POU domain, class 2, transcription factor 1
13	9606.ENSP00000442924	0.979	Histone-lysine N-methyltransferase SETD1B
14	9606.ENSP00000335677	0.977	Forkhead box protein K2
15	9606.ENSP00000254250	0.976	THAP domain-containing protein 1
16	9606.ENSP00000304689	0.973	THAP domain-containing protein 11
17	9606.ENSP00000364839	0.972	Putative Polycomb group protein ASXL1
18	9606.ENSP00000406037	0.972	Histone acetyltransferase KAT8
19	9606.ENSP00000349640	0.963	Microspherule protein 1
20	9606.ENSP00000390475	0.963	CXXC-type zinc finger protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003676	0.953	nucleic acid binding
GO:0003682	0.934	chromatin binding
GO:0003677	0.837	DNA binding
GO:0043565	0.664	sequence-specific DNA binding
GO:0003690	0.623	double-stranded DNA binding
GO:1990837	0.612	sequence-specific double-stranded DNA binding
GO:0001067	0.430	transcription regulatory region nucleic acid binding
GO:0000976	0.408	transcription cis-regulatory region binding
GO:0000978	0.302	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0048522	0.991	positive regulation of cellular process
GO:0010468	0.977	regulation of gene expression
GO:1903506	0.935	regulation of nucleic acid-templated transcription
GO:0006355	0.934	regulation of DNA-templated transcription
GO:0009987	0.903	cellular process
GO:0009893	0.883	positive regulation of metabolic process
GO:0051726	0.882	regulation of cell cycle
GO:0010604	0.871	positive regulation of macromolecule metabolic process
GO:0071704	0.852	organic substance metabolic process
GO:0044238	0.847	primary metabolic process
GO:0006807	0.827	nitrogen compound metabolic process
GO:0051173	0.801	positive regulation of nitrogen compound metabolic process
GO:0006357	0.766	regulation of transcription by RNA polymerase II
GO:0031325	0.748	positive regulation of cellular metabolic process
GO:0043170	0.727	macromolecule metabolic process
GO:0010557	0.690	positive regulation of macromolecule biosynthetic process
GO:0045935	0.669	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.648	positive regulation of DNA-templated transcription
GO:0045944	0.530	positive regulation of transcription by RNA polymerase II
GO:0048519	0.488	negative regulation of biological process
GO:1901564	0.482	organonitrogen compound metabolic process
GO:0048523	0.482	negative regulation of cellular process
GO:0019538	0.469	protein metabolic process
GO:0036211	0.459	protein modification process
GO:0065008	0.438	regulation of biological quality
GO:0032502	0.385	developmental process
GO:0009892	0.383	negative regulation of metabolic process
GO:0050896	0.377	response to stimulus
GO:0044237	0.354	cellular metabolic process
GO:0010605	0.351	negative regulation of macromolecule metabolic process
GO:0048856	0.349	anatomical structure development
GO:0031324	0.345	negative regulation of cellular metabolic process
GO:0051172	0.343	negative regulation of nitrogen compound metabolic process
GO:0016570	0.324	histone modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0043232	0.958	intracellular non-membrane-bounded organelle
GO:0032991	0.924	protein-containing complex
GO:0005737	0.882	cytoplasm
GO:0005694	0.800	chromosome
GO:1990234	0.586	transferase complex
GO:0000785	0.585	chromatin
GO:0140513	0.556	nuclear protein-containing complex
GO:0071944	0.436	cell periphery
GO:0034708	0.416	methyltransferase complex
GO:0016020	0.388	membrane
GO:0035097	0.383	histone methyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]