StarFunc result for job id P51617

User Input

>input (712 residues)
MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE
RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS
IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK
PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR
LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL
HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG
LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG
QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP
RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP
SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR
SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI
IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51617	0.999	0.999	0.000	712	1.000	1.000	P51617.pdb.gz	IRAK1_HUMAN Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1 PE=1 SV=2
2	AFDB:B2RYH5	0.543	0.544	2.916E-92	710	0.805	0.807	B2RYH5.pdb.gz	B2RYH5_RAT Interleukin-1 receptor-associated kinase 1 (Predicted) OS=Rattus norvegicus OX=10116 GN=Irak1 PE=2 SV=1
3	AFDB:Q99J34	0.488	0.485	1.011E-83	717	0.764	0.759	Q99J34.pdb.gz	Q99J34_MOUSE Irak1 protein OS=Mus musculus OX=10090 GN=Irak1 PE=1 SV=1
4	AFDB:Q8R4K2	0.417	0.633	6.879E-31	459	0.198	0.307	Q8R4K2.pdb.gz	IRAK4_MOUSE Interleukin-1 receptor-associated kinase 4 OS=Mus musculus OX=10090 GN=Irak4 PE=1 SV=1
5	AFDB:Q9FID9	0.383	0.313	1.230E-27	880	0.181	0.147	Q9FID9.pdb.gz	Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana OX=3702 GN=At5g38990 PE=2 SV=1
6	AFDB:Q9SII6	0.391	0.659	4.395E-27	414	0.180	0.309	Q9SII6.pdb.gz	PIX13_ARATH Probable serine/threonine-protein kinase PIX13 OS=Arabidopsis thaliana OX=3702 GN=PIX13 PE=1 SV=2
7	AFDB:P43293	0.389	0.691	1.570E-26	389	0.181	0.332	P43293.pdb.gz	PBL11_ARATH Probable serine/threonine-protein kinase PBL11 OS=Arabidopsis thaliana OX=3702 GN=PBL11 PE=1 SV=2
8	AFDB:O48814	0.396	0.692	2.865E-25	395	0.170	0.306	O48814.pdb.gz	BIK1_ARATH Serine/threonine-protein kinase BIK1 OS=Arabidopsis thaliana OX=3702 GN=BIK1 PE=1 SV=1
9	AFDB:P46573	0.384	0.648	5.280E-25	412	0.171	0.296	P46573.pdb.gz	PBL10_ARATH Probable serine/threonine-protein kinase PBL10 OS=Arabidopsis thaliana OX=3702 GN=PBL10 PE=1 SV=2
10	AFDB:Q8VZJ9	0.395	0.671	5.226E-24	411	0.162	0.280	Q8VZJ9.pdb.gz	CRCK2_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 2 OS=Arabidopsis thaliana OX=3702 GN=CRCK2 PE=2 SV=1
11	PDB:8dksA	0.368	0.903	1.218E-22	283	0.152	0.382	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
12	PDB:2qkwB	0.331	0.780	1.194E-20	292	0.133	0.325	2qkwB.pdb.gz
13	PDB:5tosA	0.330	0.793	5.910E-17	280	0.131	0.332	5tosA.pdb.gz
14	PDB:6j5tH	0.362	0.751	1.464E-15	327	0.118	0.257	6j5tH.pdb.gz	Reconstitution and structure of a plant NLR resistosome conferring immunity.
15	PDB:1k9aB	0.302	0.473	4.180E-13	441	0.096	0.154	1k9aB.pdb.gz
16	PDB:6j5wB	0.320	0.697	7.321E-13	306	0.101	0.235	6j5wB.pdb.gz	Ligand-triggered allosteric ADP release primes a plant NLR complex.
17	PDB:6lk5A	0.294	0.745	3.933E-12	265	0.086	0.230	6lk5A.pdb.gz
18	PDB:4yc3A	0.288	0.646	4.822E-12	295	0.101	0.244	4yc3A.pdb.gz
19	PDB:5u6yA	0.285	0.429	5.339E-12	459	0.088	0.137	5u6yA.pdb.gz
20	PDB:2h8hA	0.285	0.438	5.911E-12	445	0.094	0.151	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JYX9	0.0	1098	711	0.806	0.807	A0A0G2JYX9_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
2	A0A8I5ZRN5	0.0	775	631	0.535	0.604	A0A8I5ZRN5_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
3	A0A8I6AR42	0.0	1081	709	0.787	0.790	A0A8I6AR42_RAT Interleukin-1 receptor-associated kinase 1 OS=Rattus norvegicus OX=10116 GN=Irak1 PE=1 SV=1
4	B2RYH5	0.0	1103	710	0.806	0.808	B2RYH5_RAT Interleukin-1 receptor-associated kinase 1 (Predicted) OS=Rattus norvegicus OX=10116 GN=Irak1 PE=2 SV=1
5	P51617	0.0	1441	712	1.000	1.000	IRAK1_HUMAN Interleukin-1 receptor-associated kinase 1 OS=Homo sapiens OX=9606 GN=IRAK1 PE=1 SV=2
6	Q62406	0.0	1094	710	0.810	0.813	IRAK1_MOUSE Interleukin-1 receptor-associated kinase 1 OS=Mus musculus OX=10090 GN=Irak1 PE=1 SV=3
7	Q99J34	0.0	1009	717	0.767	0.762	Q99J34_MOUSE Irak1 protein OS=Mus musculus OX=10090 GN=Irak1 PE=1 SV=1
8	H7C1F0	3.01e-120	361	234	0.251	0.765	H7C1F0_HUMAN Interleukin 1 receptor associated kinase 1 (Fragment) OS=Homo sapiens OX=9606 GN=IRAK1 PE=1 SV=1
9	O43187	2.39e-65	229	625	0.278	0.317	IRAK2_HUMAN Interleukin-1 receptor-associated kinase-like 2 OS=Homo sapiens OX=9606 GN=IRAK2 PE=1 SV=2
10	Q8K4B2	1.18e-62	222	609	0.230	0.269	IRAK3_MOUSE Interleukin-1 receptor-associated kinase 3 OS=Mus musculus OX=10090 GN=Irak3 PE=1 SV=2
11	Q4QQS0	1.34e-60	216	624	0.275	0.314	IRAK2_RAT Interleukin-1 receptor-associated kinase-like 2 OS=Rattus norvegicus OX=10116 GN=Irak2 PE=2 SV=1
12	Q8CFA1	1.40e-58	211	622	0.260	0.297	IRAK2_MOUSE Interleukin-1 receptor-associated kinase-like 2 OS=Mus musculus OX=10090 GN=Irak2 PE=2 SV=2
13	Q9Y616	7.63e-58	208	596	0.221	0.263	IRAK3_HUMAN Interleukin-1 receptor-associated kinase 3 OS=Homo sapiens OX=9606 GN=IRAK3 PE=1 SV=2
14	B0UYS2	1.84e-57	208	630	0.228	0.257	B0UYS2_DANRE Interleukin-1 receptor-associated kinase 3 OS=Danio rerio OX=7955 GN=irak3 PE=4 SV=1
15	Q69FE3	3.42e-51	187	460	0.215	0.333	Q69FE3_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
16	Q9NWZ3	3.42e-51	187	460	0.215	0.333	IRAK4_HUMAN Interleukin-1 receptor-associated kinase 4 OS=Homo sapiens OX=9606 GN=IRAK4 PE=1 SV=1
17	A0A8I6G1H3	2.20e-50	184	461	0.209	0.323	A0A8I6G1H3_RAT Interleukin-1 receptor-associated kinase 4 OS=Rattus norvegicus OX=10116 GN=Irak4 PE=1 SV=1
18	Q8R4K2	4.15e-50	184	459	0.208	0.322	IRAK4_MOUSE Interleukin-1 receptor-associated kinase 4 OS=Mus musculus OX=10090 GN=Irak4 PE=1 SV=1
19	D4A7K4	6.99e-49	180	455	0.205	0.321	D4A7K4_RAT Interleukin-1 receptor-associated kinase 4 OS=Rattus norvegicus OX=10116 GN=Irak4 PE=1 SV=2
20	O49839	8.35e-48	176	426	0.162	0.270	PBL2_ARATH Probable serine/threonine-protein kinase PBL2 OS=Arabidopsis thaliana OX=3702 GN=PBL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	46	15.3	Phosphotransferase enzyme family
2	PF00531 Death	4.8e-06	38.0	Death domain
3	PF00069 Pkinase	2.8e-35	133.5	Protein kinase domain
4	PF07714 PK_Tyr_Ser-Thr	2.9e-31	120.3	Protein tyrosine and serine/threonine kinase
5	PF04901 RAMP	67	14.9	Receptor activity modifying family
6	PF07387 Seadorna_VP7	9.9e+02	10.2	Seadornavirus VP7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314733	0.999	Toll-interacting protein
2	9606.ENSP00000363089	0.999	Toll-like receptor 4
3	9606.ENSP00000401399	0.999	Myeloid differentiation primary response protein MyD88
4	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
5	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
6	9606.ENSP00000351789	0.998	E3 ubiquitin-protein ligase pellino homolog 1
7	9606.ENSP00000386380	0.998	Interleukin-1 receptor type 1
8	9606.ENSP00000356426	0.997	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
9	9606.ENSP00000260010	0.995	Toll-like receptor 2
10	9606.ENSP00000314807	0.995	Interleukin 1 receptor accessory protein
11	9606.ENSP00000267460	0.991	E3 ubiquitin-protein ligase pellino homolog 2
12	9606.ENSP00000380697	0.991	Interferon regulatory factor 7
13	9606.ENSP00000390651	0.991	Interleukin-1 receptor-associated kinase 4
14	9606.ENSP00000376445	0.990	Toll/interleukin-1 receptor domain-containing adapter protein
15	9606.ENSP00000358335	0.988	Mitogen-activated protein kinase kinase kinase 7
16	9606.ENSP00000454207	0.987	TNF receptor-associated factor 3
17	9606.ENSP00000216797	0.985	NF-kappa-B inhibitor alpha
18	9606.ENSP00000261233	0.984	Interleukin-1 receptor-associated kinase 3
19	9606.ENSP00000322532	0.981	E3 ubiquitin-protein ligase pellino homolog 3
20	9606.ENSP00000256458	0.980	Interleukin-1 receptor-associated kinase-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004672	0.999	protein kinase activity
GO:0004674	0.941	protein serine/threonine kinase activity
GO:0019899	0.879	enzyme binding
GO:0042802	0.872	identical protein binding
GO:0031072	0.626	heat shock protein binding
GO:0046983	0.575	protein dimerization activity
GO:0019900	0.534	kinase binding
GO:0098772	0.481	molecular function regulator activity
GO:0019901	0.435	protein kinase binding
GO:0042803	0.320	protein homodimerization activity
GO:0046982	0.310	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007165	0.980	signal transduction
GO:0044237	0.979	cellular metabolic process
GO:0048522	0.978	positive regulation of cellular process
GO:0042221	0.977	response to chemical
GO:0043412	0.977	macromolecule modification
GO:0019538	0.975	protein metabolic process
GO:0036211	0.974	protein modification process
GO:0010033	0.969	response to organic substance
GO:0016310	0.966	phosphorylation
GO:0006468	0.961	protein phosphorylation
GO:0051707	0.960	response to other organism
GO:0007166	0.949	cell surface receptor signaling pathway
GO:0002237	0.945	response to molecule of bacterial origin
GO:0034097	0.940	response to cytokine
GO:0010468	0.936	regulation of gene expression
GO:0048584	0.935	positive regulation of response to stimulus
GO:0071222	0.935	cellular response to lipopolysaccharide
GO:0006950	0.934	response to stress
GO:0010604	0.934	positive regulation of macromolecule metabolic process
GO:0080090	0.931	regulation of primary metabolic process
GO:0051171	0.931	regulation of nitrogen compound metabolic process
GO:0019221	0.924	cytokine-mediated signaling pathway
GO:0051090	0.915	regulation of DNA-binding transcription factor activity
GO:0031349	0.914	positive regulation of defense response
GO:0045088	0.910	regulation of innate immune response
GO:0050778	0.906	positive regulation of immune response
GO:0035556	0.899	intracellular signal transduction
GO:0002253	0.887	activation of immune response
GO:0002764	0.886	immune response-regulating signaling pathway
GO:0045089	0.885	positive regulation of innate immune response
GO:0051173	0.877	positive regulation of nitrogen compound metabolic process
GO:0002758	0.877	innate immune response-activating signaling pathway
GO:0000165	0.856	MAPK cascade
GO:0048660	0.850	regulation of smooth muscle cell proliferation
GO:0031098	0.846	stress-activated protein kinase signaling cascade
GO:0051403	0.844	stress-activated MAPK cascade
GO:0044093	0.843	positive regulation of molecular function
GO:0048661	0.832	positive regulation of smooth muscle cell proliferation
GO:0031325	0.824	positive regulation of cellular metabolic process
GO:0042325	0.812	regulation of phosphorylation
GO:0051247	0.808	positive regulation of protein metabolic process
GO:1902533	0.790	positive regulation of intracellular signal transduction
GO:0071456	0.783	cellular response to hypoxia
GO:0031399	0.779	regulation of protein modification process
GO:0050790	0.765	regulation of catalytic activity
GO:0001817	0.749	regulation of cytokine production
GO:0048519	0.721	negative regulation of biological process
GO:0009408	0.683	response to heat
GO:0070555	0.673	response to interleukin-1
GO:0001819	0.570	positive regulation of cytokine production
GO:0006952	0.569	defense response
GO:0098542	0.561	defense response to other organism
GO:0048523	0.473	negative regulation of cellular process
GO:0007254	0.432	JNK cascade
GO:0009892	0.410	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005829	0.986	cytosol
GO:0043226	0.981	organelle
GO:0043229	0.972	intracellular organelle
GO:0043227	0.961	membrane-bounded organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0071944	0.829	cell periphery
GO:0005886	0.817	plasma membrane
GO:0012505	0.813	endomembrane system
GO:0005634	0.718	nucleus
GO:0031982	0.646	vesicle
GO:0032991	0.585	protein-containing complex
GO:0031974	0.577	membrane-enclosed lumen
GO:0070013	0.479	intracellular organelle lumen
GO:0005654	0.456	nucleoplasm
GO:0031410	0.416	cytoplasmic vesicle
GO:0031090	0.407	organelle membrane
GO:0098588	0.330	bounding membrane of organelle
GO:0043228	0.300	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.999	Phosphotransferases with an alcohol group as acceptor.

[back to server]