StarFunc result for job id P51636

User Input

>input (162 residues)
MGLETEKADVQLFMDDDSYSHHSGLEYADPEKFADSDQDRDPHRLNSHLKLGFEDVIAEP
VTTHSFDKVWICSHALFEISKYVMYKFLTVFLAIPLAFIAGILFATLSCLHIWILMPFVK
TCLMVLPSVQTIWKSVTDVIIAPLCTSVGRCFSSVSLQLSQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P51636	1.000	1.000	1.348E-26	162	1.000	1.000	P51636.pdb.gz	CAV2_HUMAN Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2 PE=1 SV=2
2	AFDB:Q66WT7	0.805	0.805	3.121E-23	162	0.883	0.883	Q66WT7.pdb.gz	CAV2_BOVIN Caveolin-2 OS=Bos taurus OX=9913 GN=CAV2 PE=1 SV=1
3	AFDB:Q2IBC5	0.763	0.763	4.867E-22	162	0.889	0.889	Q2IBC5.pdb.gz	CAV2_RAT Caveolin-2 OS=Rattus norvegicus OX=10116 GN=Cav2 PE=1 SV=2
4	AFDB:W5UMJ4	0.561	0.513	1.132E-8	180	0.352	0.317	W5UMJ4.pdb.gz	W5UMJ4_ICTPU Caveolin OS=Ictalurus punctatus OX=7998 GN=cav1 PE=2 SV=1
5	AFDB:P51637	0.450	0.479	2.133E-8	151	0.321	0.344	P51637.pdb.gz	CAV3_MOUSE Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1
6	AFDB:P33724	0.494	0.456	2.456E-8	178	0.315	0.287	P33724.pdb.gz	CAV1_CANLF Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CAV1 PE=1 SV=1
7	AFDB:Q6YLH9	0.451	0.408	3.034E-8	181	0.315	0.282	Q6YLH9.pdb.gz	Q6YLH9_DANRE Caveolin OS=Danio rerio OX=7955 GN=CAV1 PE=1 SV=1
8	AFDB:P35431	0.443	0.407	3.747E-8	178	0.315	0.287	P35431.pdb.gz	CAV1_CHICK Caveolin-1 OS=Gallus gallus OX=9031 GN=CAV1 PE=2 SV=1
9	AFDB:Q6YLH7	0.452	0.484	4.314E-8	150	0.327	0.353	Q6YLH7.pdb.gz	Q6YLH7_DANRE Caveolin OS=Danio rerio OX=7955 GN=im:6902906 PE=1 SV=1
10	PDB:7sc0A	0.351	0.415	1.537E-6	129	0.302	0.380	7sc0A.pdb.gz
11	AFDB:Q94051	0.383	0.283	5.564E-6	235	0.216	0.149	Q94051.pdb.gz	CAV1_CAEEL Caveolin-1 OS=Caenorhabditis elegans OX=6239 GN=cav-1 PE=2 SV=1
12	PDB:5mqfL	0.210	0.132	9.283E-1	336	0.111	0.054	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
13	PDB:7rroP	0.209	0.109	3.539	373	0.142	0.062	7rroP.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:6elzJ	0.256	0.278	8.239	145	0.136	0.152	6elzJ.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51636	1.68e-118	333	162	1.000	1.000	CAV2_HUMAN Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2 PE=1 SV=2
2	Q9WVC3	1.05e-107	305	162	0.901	0.901	CAV2_MOUSE Caveolin-2 OS=Mus musculus OX=10090 GN=Cav2 PE=1 SV=1
3	Q2IBC5	1.09e-105	300	162	0.889	0.889	CAV2_RAT Caveolin-2 OS=Rattus norvegicus OX=10116 GN=Cav2 PE=1 SV=2
4	Q66WT7	1.71e-105	300	162	0.883	0.883	CAV2_BOVIN Caveolin-2 OS=Bos taurus OX=9913 GN=CAV2 PE=1 SV=1
5	W5UMJ4	2.44e-29	107	180	0.340	0.306	W5UMJ4_ICTPU Caveolin OS=Ictalurus punctatus OX=7998 GN=cav1 PE=2 SV=1
6	Q03135	7.77e-29	106	178	0.315	0.287	CAV1_HUMAN Caveolin-1 OS=Homo sapiens OX=9606 GN=CAV1 PE=1 SV=4
7	Q6RVA9	8.80e-28	103	178	0.296	0.270	CAV1_PIG Caveolin-1 OS=Sus scrofa OX=9823 GN=CAV1 PE=2 SV=1
8	Q6YLH9	1.06e-27	103	181	0.315	0.282	Q6YLH9_DANRE Caveolin OS=Danio rerio OX=7955 GN=CAV1 PE=1 SV=1
9	Q6YLH8	1.22e-27	102	148	0.315	0.345	Q6YLH8_DANRE Caveolin OS=Danio rerio OX=7955 GN=wu:fc07c04 PE=1 SV=1
10	P33724	1.98e-27	102	178	0.296	0.270	CAV1_CANLF Caveolin-1 OS=Canis lupus familiaris OX=9615 GN=CAV1 PE=1 SV=1
11	P79132	2.79e-27	102	178	0.296	0.270	CAV1_BOVIN Caveolin-1 OS=Bos taurus OX=9913 GN=CAV1 PE=2 SV=1
12	P41350	3.94e-27	102	178	0.296	0.270	CAV1_RAT Caveolin-1 OS=Rattus norvegicus OX=10116 GN=Cav1 PE=1 SV=3
13	P49817	5.99e-27	101	178	0.296	0.270	CAV1_MOUSE Caveolin-1 OS=Mus musculus OX=10090 GN=Cav1 PE=1 SV=1
14	P35431	2.57e-26	100	178	0.296	0.270	CAV1_CHICK Caveolin-1 OS=Gallus gallus OX=9031 GN=CAV1 PE=2 SV=1
15	P56539	1.27e-25	97.4	151	0.302	0.325	CAV3_HUMAN Caveolin-3 OS=Homo sapiens OX=9606 GN=CAV3 PE=1 SV=1
16	Q2KI43	1.57e-25	97.1	151	0.296	0.318	CAV3_BOVIN Caveolin-3 OS=Bos taurus OX=9913 GN=CAV3 PE=2 SV=1
17	Q6YLH7	9.09e-25	95.1	150	0.302	0.327	Q6YLH7_DANRE Caveolin OS=Danio rerio OX=7955 GN=im:6902906 PE=1 SV=1
18	P51638	2.17e-24	94.4	151	0.290	0.311	CAV3_RAT Caveolin-3 OS=Rattus norvegicus OX=10116 GN=Cav3 PE=1 SV=1
19	P51637	8.07e-24	92.8	151	0.290	0.311	CAV3_MOUSE Caveolin-3 OS=Mus musculus OX=10090 GN=Cav3 PE=1 SV=1
20	Q18879	1.27e-16	77.4	351	0.278	0.128	CAV2_CAEEL Caveolin-2 OS=Caenorhabditis elegans OX=6239 GN=cav-2 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01146 Caveolin	3.9e-55	196.9	Caveolin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222693

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339191	0.998	Caveolin-1
2	9606.ENSP00000275493	0.974	Epidermal growth factor receptor
3	9606.ENSP00000307046	0.970	Syndecan-2
4	9606.ENSP00000407586	0.939	GTPase HRas
5	9606.ENSP00000362680	0.935	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000297494	0.888	Nitric oxide synthase, endothelial
7	9606.ENSP00000368752	0.874	Major prion protein
8	9606.ENSP00000346671	0.863	Tyrosine-protein kinase Fyn
9	9606.ENSP00000360423	0.860	Voltage-dependent N-type calcium channel subunit alpha-1B
10	9606.ENSP00000272298	0.837	Calmodulin 2 (phosphorylase kinase, delta)
11	9606.ENSP00000341940	0.834	Caveolin-3
12	9606.ENSP00000335153	0.833	Heat shock protein HSP 90-alpha
13	9606.ENSP00000299767	0.809	Endoplasmin
14	9606.ENSP00000360609	0.807	Heat shock protein HSP 90-beta
15	9606.ENSP00000349541	0.805	Caveolae-associated protein 1
16	9606.ENSP00000304643	0.800	Calmodulin-like protein 6
17	9606.ENSP00000315299	0.800	Calmodulin-like protein 3
18	9606.ENSP00000369689	0.800	Calmodulin-like protein 5
19	9606.ENSP00000419081	0.800	Calmodulin-like protein 4
20	9606.ENSP00000356545	0.797	Voltage-dependent R-type calcium channel subunit alpha-1E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.960	enzyme binding
GO:0046983	0.927	protein dimerization activity
GO:0042802	0.843	identical protein binding
GO:0019900	0.711	kinase binding
GO:0005102	0.704	signaling receptor binding
GO:0050780	0.612	dopamine receptor binding
GO:0042803	0.540	protein homodimerization activity
GO:0098772	0.337	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0051179	0.983	localization
GO:0016043	0.982	cellular component organization
GO:0023051	0.979	regulation of signaling
GO:0010646	0.979	regulation of cell communication
GO:0007167	0.979	enzyme-linked receptor protein signaling pathway
GO:0048523	0.967	negative regulation of cellular process
GO:0042127	0.966	regulation of cell population proliferation
GO:0009966	0.966	regulation of signal transduction
GO:0009719	0.962	response to endogenous stimulus
GO:0048518	0.954	positive regulation of biological process
GO:0050678	0.941	regulation of epithelial cell proliferation
GO:0048522	0.941	positive regulation of cellular process
GO:0071495	0.904	cellular response to endogenous stimulus
GO:0042221	0.888	response to chemical
GO:0032502	0.865	developmental process
GO:0019222	0.860	regulation of metabolic process
GO:0010033	0.860	response to organic substance
GO:0051234	0.859	establishment of localization
GO:0070887	0.858	cellular response to chemical stimulus
GO:0006810	0.854	transport
GO:1901700	0.852	response to oxygen-containing compound
GO:0048584	0.851	positive regulation of response to stimulus
GO:0051174	0.840	regulation of phosphorus metabolic process
GO:0071310	0.830	cellular response to organic substance
GO:1901699	0.816	cellular response to nitrogen compound
GO:0010243	0.806	response to organonitrogen compound
GO:0001936	0.780	regulation of endothelial cell proliferation
GO:0009967	0.770	positive regulation of signal transduction
GO:1901701	0.766	cellular response to oxygen-containing compound
GO:0006996	0.750	organelle organization
GO:0010256	0.722	endomembrane system organization
GO:1902531	0.699	regulation of intracellular signal transduction
GO:0032879	0.690	regulation of localization
GO:0071417	0.684	cellular response to organonitrogen compound
GO:0008283	0.681	cell population proliferation
GO:0007169	0.680	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048856	0.671	anatomical structure development
GO:1901653	0.667	cellular response to peptide
GO:0061024	0.661	membrane organization
GO:0060255	0.623	regulation of macromolecule metabolic process
GO:0050680	0.613	negative regulation of epithelial cell proliferation
GO:0032501	0.595	multicellular organismal process
GO:0008286	0.592	insulin receptor signaling pathway
GO:0043408	0.576	regulation of MAPK cascade
GO:0001937	0.567	negative regulation of endothelial cell proliferation
GO:0022607	0.528	cellular component assembly
GO:0080090	0.521	regulation of primary metabolic process
GO:0051171	0.517	regulation of nitrogen compound metabolic process
GO:0016192	0.516	vesicle-mediated transport
GO:0019220	0.487	regulation of phosphate metabolic process
GO:0065009	0.470	regulation of molecular function
GO:0009893	0.440	positive regulation of metabolic process
GO:0042325	0.433	regulation of phosphorylation
GO:1902533	0.397	positive regulation of intracellular signal transduction
GO:0044093	0.390	positive regulation of molecular function
GO:0050790	0.386	regulation of catalytic activity
GO:0051239	0.375	regulation of multicellular organismal process
GO:0031399	0.369	regulation of protein modification process
GO:0065008	0.328	regulation of biological quality
GO:0010604	0.320	positive regulation of macromolecule metabolic process
GO:0051128	0.318	regulation of cellular component organization
GO:0031325	0.311	positive regulation of cellular metabolic process
GO:0009968	0.311	negative regulation of signal transduction
GO:0008152	0.310	metabolic process
GO:0001932	0.308	regulation of protein phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005901	0.998	caveola
GO:0043229	0.996	intracellular organelle
GO:0012505	0.994	endomembrane system
GO:0043227	0.982	membrane-bounded organelle
GO:0005737	0.980	cytoplasm
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0032991	0.926	protein-containing complex
GO:0031982	0.819	vesicle
GO:0031410	0.530	cytoplasmic vesicle
GO:0031090	0.479	organelle membrane
GO:0070161	0.420	anchoring junction
GO:0030055	0.414	cell-substrate junction
GO:0005925	0.402	focal adhesion
GO:0005634	0.307	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]