StarFunc result for job id P51649

User Input

>input (535 residues)
MATCIWLRSCGARRLGSTFPGCRLRPRAGGLVPASGPAPGPAQLRCYAGRLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVREARAAVRAAYEAFCRWREVSAKER
SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIH
TPAKDRRALVLKQPIGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AELASQAGIPSGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAVAGAMASKFRNTGQTCVCSNQFLVQRGIHDAFVKAF
AEAMKKNLRVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATVVTGGKRHQLGKNFF
EPTLLCNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANAADVGLAGYFYSQDPAQIWR
VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:X5D299	0.931	0.909	0.000	548	1.000	0.976	X5D299.pdb.gz	X5D299_HUMAN Succinate-semialdehyde dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=2 SV=1
2	AFDB:P51650	0.909	0.930	1.459E-97	523	0.839	0.859	P51650.pdb.gz	SSDH_RAT Succinate-semialdehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh5a1 PE=1 SV=2
3	AFDB:C9J8Q5	0.850	0.897	2.710E-94	507	0.948	1.000	C9J8Q5.pdb.gz	C9J8Q5_HUMAN Succinate-semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=1
4	PDB:2w8qA	0.901	0.994	7.507E-93	485	0.903	0.996	2w8qA.pdb.gz	Redox-Switch Modulation of Human Ssadh by Dynamic Catalytic Loop.
5	AFDB:Q9I6M5	0.888	0.983	3.060E-75	483	0.521	0.578	Q9I6M5.pdb.gz	DAVD_PSEAE Glutarate-semialdehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=davD PE=1 SV=1
6	AFDB:Q39Q67	0.887	0.980	9.409E-75	484	0.510	0.564	Q39Q67.pdb.gz	Q39Q67_GEOMG 4-oxobutanoate dehydrogenase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=gabD PE=3 SV=2
7	AFDB:Q9SAK4	0.881	0.892	4.536E-74	528	0.527	0.534	Q9SAK4.pdb.gz	SSDH_ARATH Succinate-semialdehyde dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH5F1 PE=1 SV=2
8	AFDB:P25526	0.884	0.981	1.954E-73	482	0.497	0.552	P25526.pdb.gz	GABD_ECOLI Succinate-semialdehyde dehydrogenase [NADP(+)] GabD OS=Escherichia coli (strain K12) OX=83333 GN=gabD PE=1 SV=1
9	PDB:3jz4A	0.878	0.977	4.835E-73	481	0.499	0.555	3jz4A.pdb.gz	The X-ray crystal structure of Escherichia coli succinic semialdehyde dehydrogenase; structural insights into NADP+/enzyme interactions.
10	AFDB:A0A5F9ZI23	0.750	0.982	6.727E-72	408	0.755	0.990	A0A5F9ZI23.pdb.gz	A0A5F9ZI23_HUMAN Aldehyde dehydrogenase 5 family member A1 (Fragment) OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=1
11	AFDB:Q6F9G0	0.881	0.975	3.242E-71	483	0.480	0.532	Q6F9G0.pdb.gz	TGNE_ACIAD Succinate semialdehyde dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=tgnE PE=1 SV=1
12	AFDB:Q9VBP6	0.887	0.932	7.119E-71	509	0.492	0.517	Q9VBP6.pdb.gz	Q9VBP6_DROME Succinate-semialdehyde dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Ssadh PE=1 SV=1
13	PDB:5x5tA	0.864	0.970	1.340E-55	476	0.363	0.408	5x5tA.pdb.gz	Structural insights into the production of 3-hydroxypropionic acid by aldehyde dehydrogenase from Azospirillum brasilense.
14	PDB:6aljA	0.870	0.945	1.499E-55	492	0.320	0.348	6aljA.pdb.gz	Structural Basis of ALDH1A2 Inhibition by Irreversible and Reversible Small Molecule Inhibitors.
15	PDB:4fr8C	0.862	0.929	3.481E-55	496	0.303	0.327	4fr8C.pdb.gz	Vascular Bioactivation of Nitroglycerin by Aldehyde Dehydrogenase-2: REACTION INTERMEDIATES REVEALED BY CRYSTALLOGRAPHY AND MASS SPECTROMETRY.
16	PDB:7rluA	0.856	0.786	6.458E-55	583	0.312	0.286	7rluA.pdb.gz	Structure of putative tumor suppressor ALDH1L1.
17	PDB:5abmA	0.858	0.928	1.267E-54	494	0.320	0.346	5abmA.pdb.gz	Structural, Biochemical, and Computational Studies Reveal the Mechanism of Selective Aldehyde Dehydrogenase 1A1 Inhibition by Cytotoxic Duocarmycin Analogues.
18	PDB:3iwjA	0.861	0.920	1.586E-54	500	0.323	0.346	3iwjA.pdb.gz	Structural and functional characterization of plant aminoaldehyde dehydrogenase from Pisum sativum with a broad specificity for natural and synthetic aminoaldehydes.
19	PDB:4v37A	0.857	0.925	3.113E-54	495	0.310	0.335	4v37A.pdb.gz	Identification of a Stable Thiohemiacetal Involving a Conserved Cysteine in the Substrate Inactivation of S. Oleracea Betaine Aldehyde Dehydrogenase
20	PDB:2iluA	0.859	0.962	4.360E-54	477	0.318	0.356	2iluA.pdb.gz	Crystal structure of lactaldehyde dehydrogenase from Escherichia coli and inferences regarding substrate and cofactor specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5F9ZI23	0.0	816	408	0.763	1.000	A0A5F9ZI23_HUMAN Aldehyde dehydrogenase 5 family member A1 (Fragment) OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=1
2	C9J8Q5	0.0	1024	507	0.948	1.000	C9J8Q5_HUMAN Succinate-semialdehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=1
3	P25526	0.0	553	482	0.497	0.552	GABD_ECOLI Succinate-semialdehyde dehydrogenase [NADP(+)] GabD OS=Escherichia coli (strain K12) OX=83333 GN=gabD PE=1 SV=1
4	P51649	0.0	1097	535	1.000	1.000	SSDH_HUMAN Succinate-semialdehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=1 SV=2
5	P51650	0.0	904	523	0.839	0.859	SSDH_RAT Succinate-semialdehyde dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aldh5a1 PE=1 SV=2
6	Q39Q67	0.0	559	484	0.510	0.564	Q39Q67_GEOMG 4-oxobutanoate dehydrogenase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=gabD PE=3 SV=2
7	Q6F9G0	0.0	538	483	0.482	0.534	TGNE_ACIAD Succinate semialdehyde dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) OX=62977 GN=tgnE PE=1 SV=1
8	Q8BWF0	0.0	900	523	0.843	0.862	SSDH_MOUSE Succinate-semialdehyde dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Aldh5a1 PE=1 SV=1
9	Q9I6M5	0.0	572	483	0.521	0.578	DAVD_PSEAE Glutarate-semialdehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=davD PE=1 SV=1
10	Q9SAK4	0.0	563	528	0.531	0.538	SSDH_ARATH Succinate-semialdehyde dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALDH5F1 PE=1 SV=2
11	X5D299	0.0	1088	548	1.000	0.976	X5D299_HUMAN Succinate-semialdehyde dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=2 SV=1
12	X5DQN2	0.0	1097	535	1.000	1.000	X5DQN2_HUMAN Succinate-semialdehyde dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=ALDH5A1 PE=2 SV=1
13	Q9VBP6	1.12e-177	512	509	0.493	0.519	Q9VBP6_DROME Succinate-semialdehyde dehydrogenase OS=Drosophila melanogaster OX=7227 GN=Ssadh PE=1 SV=1
14	Q9US47	1.76e-170	495	547	0.458	0.448	SSDH1_SCHPO Putative succinate-semialdehyde dehydrogenase C1002.12c [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1002.12c PE=3 SV=2
15	P38067	6.35e-160	466	497	0.434	0.467	UGA2_YEAST Succinate-semialdehyde dehydrogenase [NADP(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UGA2 PE=1 SV=2
16	E1V7V8	1.63e-152	447	493	0.445	0.483	DOEC_HALED Aspartate-semialdehyde dehydrogenase (Non-phosphorylating) OS=Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9) OX=768066 GN=doeC PE=3 SV=1
17	Q9UTM8	6.06e-152	446	493	0.417	0.452	SSDH2_SCHPO Putative succinate-semialdehyde dehydrogenase C139.05 [NADP(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC139.05 PE=3 SV=1
18	Q1JUP4	3.41e-112	343	481	0.363	0.403	KGSD1_AZOBR Alpha-ketoglutaric semialdehyde dehydrogenase 1 OS=Azospirillum brasilense OX=192 GN=araE PE=1 SV=1
19	P08157	2.16e-98	308	497	0.351	0.378	ALDH_EMENI Aldehyde dehydrogenase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aldA PE=3 SV=2
20	Q6L285	2.48e-98	308	493	0.321	0.349	GADH_PICTO D-glyceraldehyde dehydrogenase (NADP(+)) OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3) OX=1122961 GN=PTO0332 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00171 Aldedh	2.1e-159	542.6	Aldehyde dehydrogenase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000054687

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000013232	0.999	4-aminobutyrate aminotransferase
2	9598.ENSPTRP00000003706	0.896	Pan troglodytes saccharopine dehydrogenase (putative) (SCCPDH), mRNA
3	9598.ENSPTRP00000004870	0.894	Delta-1-pyrroline-5-carboxylate synthase
4	9598.ENSPTRP00000033039	0.889	Malate dehydrogenase
5	9598.ENSPTRP00000044752	0.864	Catalyzes the cleavage of citrate into oxaloacetate and acetyl-CoA, the latter serving as common substrate for de novo cholesterol and fatty acid synthesis
6	9598.ENSPTRP00000032714	0.852	Uncharacterized protein
7	9598.ENSPTRP00000020567	0.843	Pan troglodytes malate dehydrogenase 1, NAD (soluble) (MDH1), transcript variant 2, mRNA
8	9598.ENSPTRP00000012542	0.838	Isocitrate dehydrogenase [NAD] subunit, mitochondrial
9	9598.ENSPTRP00000022566	0.834	Isocitrate dehydrogenase [NAD] subunit, mitochondrial
10	9598.ENSPTRP00000057012	0.834	Isocitrate dehydrogenase [NAD] subunit, mitochondrial
11	9598.ENSPTRP00000045149	0.829	Pyruvate carboxylase
12	9598.ENSPTRP00000012731	0.826	Isocitrate dehydrogenase [NADP]
13	9598.ENSPTRP00000021992	0.826	Isocitrate dehydrogenase [NADP]
14	9598.ENSPTRP00000010507	0.811	Uncharacterized protein
15	9598.ENSPTRP00000023500	0.811	Uncharacterized protein
16	9598.ENSPTRP00000042616	0.763	Terpene cyclase/mutase family member
17	9598.ENSPTRP00000030352	0.702	Uncharacterized protein
18	9598.ENSPTRP00000004500	0.694	Sphingosine-1-phosphate lyase 1
19	9598.ENSPTRP00000045638	0.693	Inositol polyphosphate-5-phosphatase, 40kDa
20	9598.ENSPTRP00000005344	0.688	Ornithine aminotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016620	0.999	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0042802	0.995	identical protein binding
GO:0004030	0.901	aldehyde dehydrogenase [NAD(P)+] activity
GO:0004029	0.799	aldehyde dehydrogenase (NAD+) activity
GO:0097159	0.320	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0019752	0.998	carboxylic acid metabolic process
GO:0044282	0.997	small molecule catabolic process
GO:0046395	0.989	carboxylic acid catabolic process
GO:0006520	0.988	amino acid metabolic process
GO:0032787	0.966	monocarboxylic acid metabolic process
GO:0009063	0.948	amino acid catabolic process
GO:0032501	0.902	multicellular organismal process
GO:0032502	0.884	developmental process
GO:0048856	0.778	anatomical structure development
GO:0007275	0.747	multicellular organism development
GO:0048731	0.519	system development
GO:0065007	0.391	biological regulation
GO:0007399	0.378	nervous system development
GO:0007417	0.374	central nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.692	intracellular organelle lumen
GO:0005759	0.514	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.2.1.-	0.999	With NAD(+) or NADP(+) as acceptor.
EC:1.2.1.5	0.901	aldehyde dehydrogenase [NAD(P)(+)].
RHEA:16185	0.799	an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH
EC:1.2.1.3	0.799	aldehyde dehydrogenase (NAD(+)).

[back to server]